KEGG   Tribolium castaneum (red flour beetle): 656106Help
Entry
656106            CDS       T01046                                 

Definition
ubiquitin specific protease 41-like
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
tca  Tribolium castaneum (red flour beetle)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG6
AA seq 764 aa AA seqDB search
MPVLSPRQSSASALTGSYRSTFSSSTIDRPYFGANYSPRITTFSERYTTRTYSDSDGRRI
FSRSGSITEDGITSRFREEGRESSIARRESLSRDSGISSIRENSIVDFGRRDSSLSRDSP
RLSSINVLDSVAELRNKYSPANYVPACLRERNNENISRSKSINDIGLPPIETTKLAKKKV
INDSLNYNNSVLSNSNTPTNNDNNMTKVEEDDNGNRASVADLRKRFDEKNTKTTKSPLVK
DLEETSFKIAENRFKKFDSKVKTLKKNNDGGPKSSGRQLDVTSQTSSSDCIINVSKLDVN
ETAAVKNGIRTHEDDGDCNEVRKTTRVNNFASYIPAKDYQKNGDDSLNGDTEQGDESTTD
LIGKRFTDISTSPKLSATSTRSAISPSTSTVNSSSSTSPSRRSSYNDDITTTATTSPIKT
QGLNGLKNIGNTCFMNSVIQCLSNTKTLLEYLLQDHYVNDINTTTSAMKGSLIKAFAEVI
KKLWSQDASDRVVNTSSLKSQIQRFAPRFIGYAQQDAQEFLRYLLEGLHEDVNRVKEKPK
PIITEIDEKLTDSEKSAESWNRYLRMDNSKIVDYFVGQLKSTLKCTHCGHCSVTFDPFWD
LSLPIPQRAGQVRLAQCLDSFTREETLDGDEKPTCSKCKERRKCTKSFTIQKFPKILVIH
LKRFSLAERFRGKLSVTVDFPLEGLDMSNYAADNITPCRYNLYAISNHSGTTYSGHYTAY
CRHPYTKAWHEYNDSRVSSISSKAIVSGEAYVLFYEQEGQKSHL
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttttatcgccgagacagagcagtgcttcggcactgacgggctcctacaggtcc
acgttcagttcctcgaccattgacaggccctactttggggccaattacagcccccggatc
accaccttcagcgagaggtacaccaccaggacctactcggactcggacggaaggaggatt
ttttcgaggtctggcagcataaccgaagacggcataaccagccgtttccgcgaagaaggc
cgtgaatcgagcatcgcccgtcgcgaatccctctcgcgcgattcgggcataagttcaatt
cgcgaaaattcaatcgttgatttcggccgtcgtgacagttccctgtcccgggacagcccc
cgtttatcctcgatcaacgttctcgattcggtcgccgaacttcgcaacaaatactcaccg
gccaactacgttcctgcatgtcttcgcgaacgcaataacgagaacatctcacgttcgaaa
tccataaacgacatcggcttaccgccgattgaaacaacaaaactcgccaaaaagaaggta
attaatgacagtttgaattacaataacagcgtgttgtccaattctaacacacctactaac
aacgacaacaacatgaccaaagtggaagaggacgataatgggaatcgggcctcggtggcc
gatttgcgcaaaagattcgacgagaaaaatacaaaaactacaaagtctccgctggttaaa
gatttggaagaaactagctttaaaatcgccgagaatcggttcaaaaaattcgattctaaa
gttaaaactttaaaaaaaaataacgatggtgggcctaaatcaagtgggcgccaattggat
gtgacaagtcaaacgtcaagttctgattgtattattaatgtatcgaaattggatgtgaac
gagactgcggcggtaaagaatggaattcggacgcacgaagatgatggggattgtaacgaa
gtgagaaaaacgacaagggttaataattttgcgtcgtatattccggcgaaagattatcaa
aaaaacggagacgattctttaaacggggacacggagcaaggggacgaaagcacgacggat
ttgatagggaagaggtttacagatatctcgacatcgccgaaactcagcgccacctcgacc
cgttcggcaatctccccctccacctcgaccgtaaactcctcgagttcgacgagtccatcg
cgtcgttcctcctacaacgatgacatcaccacaacggcaacaacgagtccaataaaaacg
caaggcctcaacggactcaaaaacatcggcaacacttgtttcatgaattccgtcattcag
tgcctctcgaacacgaaaaccctcttggagtacctcctccaggaccactacgtcaacgac
atcaacaccaccacctcagcaatgaagggttccctcattaaggcctttgccgaagtcatc
aaaaaattatggtcgcaagacgcctccgatcgtgtcgtaaatacgtccagtctcaagagt
caaatacagcgttttgcgcccagatttatcggttatgcacaacaggacgctcaggagttt
ttacggtatttgctggaggggttgcatgaggatgttaatcgggtcaaagaaaagcccaaa
ccgatcatcaccgaaattgacgagaaattgacggatagtgaaaagtcggccgagtcctgg
aatcgttacttgcgaatggataattcgaaaattgttgattattttgtcggacagttaaaa
tcaacgttgaaatgtacacattgtggccactgttcggtcacttttgatcctttttgggat
ttgtctttgccgataccgcagagggctgggcaagttaggttggcacaatgtttggattct
ttcacgagggaggaaacattggatggggacgaaaaaccaacatgttccaaatgcaaggag
cgtaggaaatgcaccaagtcgtttactattcagaaatttcccaagattttagtgatacat
ttgaaacgattttcactagctgaaagatttcgcggcaagttgagtgtgaccgttgatttt
cccttagaaggcttagatatgagcaattacgcggccgataacatcactccctgtcgttac
aacttgtatgccatttcaaaccacagtggaactacgtacagtggtcattacacggcctac
tgtagacatccctacactaaagcctggcatgaatataacgattctagggtttcgtcgatt
tcttcaaaagcgatcgttagtggcgaagcctacgttcttttctacgaacaagaggggcaa
aagtcgcatctatga

DBGET integrated database retrieval system