KEGG   Tribolium castaneum (red flour beetle): 656120Help
Entry
656120            CDS       T01046                                 

Definition
UDP-glucuronosyltransferase 2B16
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    656120
   00053 Ascorbate and aldarate metabolism
    656120
   00500 Starch and sucrose metabolism
    656120
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    656120
   00860 Porphyrin and chlorophyll metabolism
    656120
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    656120
   00982 Drug metabolism - cytochrome P450
    656120
   00983 Drug metabolism - other enzymes
    656120
Enzymes [BR:tca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     656120
Glycosyltransferases [BR:tca01003]
 Others
  Hydrophobic molecule
   656120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG9
AA seq 528 aa AA seqDB search
MLVKMKTTFLLLVLVLISCYEANSAKILAVLPVAGRSHYILASTLMRALAERGHDVTVIS
CFGEKNPPKNGTYRDIVVTGAMEELEKQMSSDDVNMFEMEGINLFINALFMAFMLPTMNE
ATLKHENVQKFINSGEKFDVVIVEQFGNDAAKALSTHFGAPLISLSAVGASYWTNPLVGN
PSPPSYIPDLMSDYSVPMTFCERLVNSLVYVFNDLLYNFIVFPKQNQLMKKYIPNAPEHL
SDVLYNSSIVLLNSHPSINQPVPHVPNMIEIGGFHIKPPKKLPQDLQEFLDGAKDGIIYF
SMGSNLKSADLPNDKRDAILKTFAKLKQKILWKWEEDDLPGKPPNVKTAKWLPQQELLAH
PNVRLFITHGGLLSTTETIYHGVPILAIPIFGDQKINARSAVTSGYGVYLAFDKLSEETL
TNSINQILNNKKYKENVQMRSRLFHDRLVSPLDTAIYWVEYVIRHRGAPHLRVAALDLPW
YKYLLLDVIAVIALVLLSSLLIFCYIVKLIGRLVCSKKTKTSKKAKKE
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctagttaaaatgaaaactacattcttgctcttggttttggtgttaatttcgtgttat
gaagcaaacagtgccaaaattttggccgttttgcctgtggctggccggagccattatatc
cttgccagtacccttatgagagcacttgctgagagagggcacgatgttactgtcattagt
tgttttggggaaaagaacccaccaaaaaatggaacttacagagacattgttgtgacagga
gcaatggaagaattagagaagcaaatgagttcagacgacgtaaatatgttcgaaatggaa
ggcataaacctgttcattaatgcgctttttatggcttttatgctgcctacaatgaacgaa
gcgacactcaaacacgaaaatgtccaaaaatttatcaactctggtgaaaagttcgatgtt
gtaattgtggagcaatttggaaatgatgctgcaaaggccctatcgactcattttggggcc
ccgctgattagtctcagtgcggtgggggccagctattggacaaaccccttggttggaaac
ccgtccccaccttcctatatcccagacctcatgtccgactattcggttcctatgactttt
tgcgaaagactcgtaaacagtcttgtgtacgtttttaatgatttgttgtacaattttatt
gtttttcctaaacaaaaccaactaatgaaaaagtatattccaaatgcccccgagcattta
agcgatgtgctttacaacagttccattgttttgctaaattcccaccccagtatcaaccaa
cctgtcccacacgtacccaacatgatcgaaattgggggttttcacatcaaacccccgaaa
aaactaccacaagacctacaagaatttttggatggtgccaaagatggtatcatttacttc
agcatgggttctaatctaaaaagtgcagatttaccgaacgacaaacgcgacgcaattctt
aaaactttcgcaaaattgaaacaaaaaatcctgtggaaatgggaagaggatgatcttccg
ggaaaaccaccaaatgttaaaactgccaaatggttaccgcaacaagaacttcttgcacat
cctaacgttagactttttataactcacggtggtcttttaagcacgactgaaaccatttat
cacggagtgcctattttggcaatacctatttttggtgatcagaaaattaacgcaagatct
gcggtcacgagtggttatggtgtttacctagctttcgataaactaagcgaagagacgttg
actaacagtattaaccaaattttaaataacaaaaaatacaaagaaaacgtccaaatgcga
tcacgactttttcacgaccgtcttgttagtcctttggacacagctatttattgggtcgaa
tacgttattcgacacagaggagcacctcatctgagggttgcagccttggacttaccgtgg
tacaaatatttattactagacgttattgcagtgattgctttagtattactaagttcgtta
cttattttctgttacattgtaaaattaattggccgattagtatgttcaaagaagaccaaa
acgagcaagaaagcgaagaaagaatag

DBGET integrated database retrieval system