KEGG   Tribolium castaneum (red flour beetle): 656193Help
Entry
656193            CDS       T01046                                 

Gene name
Chc
Definition
AGAP003021-PA-like
Orthology
K04646  
clathrin heavy chain
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:tca00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    656193 (Chc)
   04142 Lysosome
    656193 (Chc)
Exosome [BR:tca04147]
 Exosomal proteins
  Proteins found in most exosomes
   656193 (Chc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG6
AA seq 1684 aa AA seqDB search
MTQQLLPIKFQEHLQLTNVGINVANISFATLTMESDKFICVREKVGDTSQVVIIDMGDTA
NPIRRPITAESAIMNPASKVIALKGKAGVEAQKTLQIFNIEMKSKMKAHTMSEDVIFWKW
ISLNTLALVTETSVYHWSMEGDSTPVKMFDRHSSLNGCQIINYRTDPKQNWLLLVGISAQ
QSRVVGAMQLYSVERKCSQPIEGHAASFATFKMEGNPEPSTLFCFAVRTVQGGKLHIIEV
GQSPAGNQPFPKKTVDVFFPPEAQNDFPVAMQVSAKYDVIYLITKYGYIHMYDIESAICI
YMNRISSETIFVTAPHESTGGIIGVNRRGQVLSVSVDEDSIIRYVNQVLHNPDLALRIAT
RNNLAGAEELFVNKFQMLFTNGQYAEAAKVAANAPKGILRTPATIQMFQQVPTQPGQNSP
LLQYFGILLDQGQLNRYESLELCKPVLLQGRKQLLEKWLKEDKLECSEELGDLVKQADST
LALSVYLRANVPAKVIQSFAETGQFQKIVLYAKKVNYTPDYIYLLRSVMRTNPDQGAAFA
SMLVADEEPLADINQIVDIFMEQNMVQQCTAFLLDALKHNRPTEGHLQTRLLEMNLMSAP
QVADAILGNNMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLPMDWLVN
FFGTLSVEDSLECLKAMLTANIRQNLQICVQIATKYHEQLTTKALIDLFESFKSYEGLFY
FLGSIVNFSQDPDVHFKYIQAACKTGQIKEVERICRESNCYNPESVKNFLKEAKLTDQLP
LIIVCDRFDFVHDLVLYLYRNSLQKYIEIYVQKVNPSRLPVVVGGLLDVDCAEDIIKNLI
LVVRGQFSTDELVEEVEKRNRLKLLLPWLESRVHEGCVEPATHNALAKIYIDSNNNAERF
LKENQWYDSRVVGRYCEKRDPHLACVAYERGQCDRELIAVCNENSLFKSEARYLVRRRDP
ELWAEVLQESNPYRRQLIDQVVQTALSETQDPEDISVTVKAFMTADLPNELIELLEKIVL
DSSVFSDHRNLQNLLILTAIKADATRVMDYINRLDNYDAPDIANIAINNHLYEEAFAIFK
KFDVNTSAIQVLIEQVNNLDRAYEFAERCNEPAVWSQLAKAQLNQGLVKEAIDSYIKADD
PSAYMAVVETASKNNSWEDLVRYLQMARKKSRESYIESELIYSYAKTGRLADLEEFISGP
NHADIQKIGDRCFDDKMYDAAKLLYNNVSNFARLAITLVHLKEFQGAVDSARKANSTRTW
KEVCFACVDAEEFRLAQMCGMHIVVHADELQDLINYYQDRGYFEELIGLLEAALGLERAH
MGMFTELAILYSKYKPAKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDN
AVLAMMAHPTEAWREGHFKDIITKVANIELYYKAIQFYLDYKPLLLNDLLLVLAPRMDHT
RAVAFFTKTGHLQLVKSYLRSVQNLNNKAINEALNSLLIEEEDFQGLRTSIDAFDNFDNI
GLAQKLEKHELTEFRRIAAYLYKGNNRWKQSVELCKKDRLFRDAMEYTAESKNQELAEEL
LAWFLERKAYDCFAACLYQCYDLLRPDVILELAWRHKIMDLAMPYLIQVTRELTTKVEKL
EQSDAQRQSEAAEETHKPMMINEPQLMLTAGPGMGIPPQAYVPPQAYAQPGYAPQMPYGA
YPGM
NT seq 5055 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaacaattactcccgataaagttccaggagcacttgcagctcacaaatgtcggg
attaacgtggccaacatctccttcgccactctcaccatggagagcgacaagttcatctgc
gtgcgggagaaggtcggggacacgtcccaggtggtcatcatcgacatgggggacaccgcc
aaccccatcagacgccccatcaccgccgagagcgcgatcatgaaccccgcctccaaagtg
atagccctcaagggcaaagcgggcgtcgaggcccaaaagaccttgcagattttcaacatc
gagatgaagtccaaaatgaaagcacacaccatgtcagaggacgtcatcttctggaagtgg
atctcgctaaacaccttggctttggtcaccgaaacctcggtgtatcattggtccatggag
ggtgactctacacctgttaaaatgtttgatcgtcactcatctctgaatggctgccaaatt
ataaactatcgcactgatcccaaacaaaactggttactattggtgggcattagtgcccaa
cagtctcgtgttgtgggcgcaatgcaactttattccgtcgaaagaaaatgttcacaaccg
atcgaaggtcatgctgcctcttttgccacattcaaaatggaaggcaatcctgaaccatcg
acacttttctgctttgccgtaagaacagtacaaggaggcaaactccacatcatcgaagtg
gggcaaagtccggccggcaaccaaccattccccaagaaaaccgtcgacgtgttcttcccc
cctgaggcccaaaacgactttcccgtagcgatgcaagtctcggcaaaatacgacgtcatc
tacttaatcacaaaatacggctacattcacatgtacgacatcgaaagcgccatctgtatc
tacatgaatcgtatctcaagcgagacaattttcgtaacagctccgcacgaatccaccggt
ggtattatcggtgtgaatcgtcgcggacaagtattgtctgtttctgtcgacgaagacagt
attattcgatatgtgaatcaagttttgcacaatcctgatctggctttacgtatcgccact
agaaataatctcgcaggcgctgaagagctgtttgtgaacaagttccaaatgttgttcacg
aatggacagtatgctgaagcggccaaagtggcagccaatgcgccgaaagggattttgaga
acaccagctacgattcaaatgttccaacaagtgcccacgcagccgggacagaacagtcca
ctgttgcagtatttcgggattttgttagatcaagggcagctaaacagatacgaatcgctg
gaattgtgcaaaccagtcctcttgcaaggccgtaaacaacttctcgaaaaatggctaaaa
gaagacaaactcgaatgttcggaagaattgggcgatctcgtaaaacaagccgactcaact
ctcgccctttctgtctatctccgagctaacgtccccgccaaagtcattcaaagttttgcc
gaaaccggtcagttccaaaaaatcgtcctctacgccaaaaaagtcaactacacacccgac
tacatttacttgctgcgctccgtcatgcggacaaaccccgaccagggggcggctttcgca
agcatgctggttgccgacgaggaaccactagccgacatcaaccaaattgtcgatattttc
atggaacaaaacatggtgcaacagtgcacggccttcttgctggacgctttgaagcacaat
aggccgaccgaaggccacctccagacgcgcctcctggagatgaacttaatgtcggcgccg
caggtcgccgacgcaatcctgggcaacaacatgtttacgcattatgacagagcccatatt
gcgcagctttgcgagaaagccgggcttttgcagagggcgctggagcactacaccgacttg
tacgacatcaagcgggctgtggtccacacccacttgctgccaatggattggctggtgaat
ttcttcgggactttgagcgttgaggacagtttggagtgtctcaaggctatgttgacggcc
aatataaggcaaaacttgcagatttgtgtacaaattgcgaccaaatatcacgaacaactt
acaacgaaagcgctgattgatttgtttgagagttttaagagttatgaagggcttttctat
tttctgggttcgattgtgaatttttcacaggatccggatgtgcatttcaagtatattcag
gcggcgtgtaagaccggacaaatcaaggaagttgaacggatttgtcgagagtcgaattgt
tataatccggagagtgtgaagaatttcctcaaggaagcgaaactgaccgatcaattgccg
ttgattattgtgtgcgatcgcttcgatttcgtgcacgatttggtgctgtatttgtacagg
aattcgctgcaaaagtacatcgagatctacgtacaaaaggtaaatcccagccgtctcccc
gtggtcgtcggcggcctcctggacgtagactgcgccgaagacatcatcaaaaacctgatc
ctcgtcgtccgtggccaattctccaccgacgaactggtcgaagaagtggagaaacgcaac
cgcttgaaactcctcctaccatggctggagagtcgcgtccacgagggctgtgtcgaaccg
gccacccacaacgccctggccaaaatctacatcgattcaaacaacaacgccgaacgtttc
ctcaaagaaaaccaatggtacgactcacgcgtcgttggccgctactgcgaaaaacgcgac
ccccatctcgcctgcgtcgcctacgagcgcggccaatgcgaccgcgaactaatcgcagtc
tgtaacgaaaactcgcttttcaaatccgaggcgagatatttagtcagacggcgggacccg
gaattatgggccgaagtcttgcaggaaagtaacccgtacaggagacaattgatcgatcaa
gtggtccagacagcgctgagcgaaacgcaagacccggaggacatctccgtgactgtcaaa
gccttcatgactgctgaccttccaaatgaattgatcgagttgcttgagaaaatcgtcctg
gacagttcggttttctccgatcaccgaaacttgcaaaacctcctgatcctaacggcgatc
aaagccgatgccacccgagtcatggactacatcaaccgtctagataattacgacgctcct
gatatcgcaaatatcgcaataaataaccatttatacgaggaggcgtttgcaattttcaag
aaattcgacgttaacacttcagccattcaggttctgatcgagcaggtgaacaatttggat
cgtgcgtatgagtttgcggagcgttgtaatgagccggcggtttggagtcagttggccaag
gcacagttgaatcaagggttggtcaaggaggcgatcgattcgtacattaaggccgatgat
ccgtcggcctatatggccgtggtggagacggcgtccaagaataactcgtgggaggatttg
gtgcggtatttgcaaatggcgaggaagaagtcacgggagagttatatcgagtcggagttg
atttattcgtatgccaagacgggacggcttgccgatttggaggagtttataagtgggccg
aatcatgccgatatacagaagatcggcgatcgatgttttgatgataaaatgtacgatgcg
gccaagttgttgtataataatgtctcgaattttgcgaggttggcgattactttggtgcat
ttgaaggagtttcagggagctgtcgacagcgcccgcaaggccaacagcacccgcacctgg
aaagaggtatgttttgcgtgcgtggacgccgaagagttccgtttggcgcaaatgtgcgga
atgcacattgtcgtccacgccgacgaactgcaagatctcatcaactactaccaagaccgc
ggctatttcgaagagctcatcggtctgctggaggccgccctaggtctcgagcgcgcccac
atgggcatgttcaccgagctggccatcctctattcgaaatacaagccggcgaaaatgcgc
gaacacctggagctgttctggtcgcgcgtcaacattcccaaagtattgcgcgccgccgaa
caggcgcatctctgggccgaactggtctttctctacgataagtacgaggagtacgataat
gccgttttggccatgatggcgcatccgacggaggcatggcgtgaaggacactttaaagat
attatcactaaagtggccaatattgagttgtactacaaggcgattcagttttatttggat
tataagccgttgttgttgaacgatttgttgctggttttggcaccgagaatggatcatacg
agggctgtggcgtttttcacaaagacgggacatttacaacttgtcaagtcttatttgagg
tcggtgcagaatttgaataataaggccattaatgaggcgctaaattcgctattgattgaa
gaagaggatttccagggtttgagaacatcgatcgacgcattcgacaatttcgacaatatc
ggcttggcccaaaaactcgaaaaacacgaactgaccgaattcagacgcatcgccgcctat
ttatacaaaggcaacaacagatggaaacagagcgtggaattatgtaagaaggatcgcctt
ttcagagatgcgatggaatacacagctgaatccaaaaatcaagaattggccgaagaacta
ctggcgtggtttttggaacgaaaggcctatgattgttttgcagcatgtctctaccaatgc
tatgatttattaaggcctgacgtaatattggaactagcctggagacataaaatcatggat
ttggcgatgccttatttgattcaagtaacgagagaattaaccacaaaagtggaaaaattg
gaacaatcggatgcacaaaggcagagcgaggccgccgaagaaacacacaagccgatgatg
atcaacgagccacagctaatgctaacggcaggacctggcatgggtattccaccgcaggcg
tacgtccccccgcaggcctacgcccagccaggctacgccccccagatgccgtacggcgct
tacccgggcatgtaa

DBGET integrated database retrieval system