KEGG   Tribolium castaneum (red flour beetle): 656193Help
Entry
656193            CDS       T01046                                 

Gene name
Chc
Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:tca00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    656193 (Chc)
   04142 Lysosome
    656193 (Chc)
Exosome [BR:tca04147]
 Exosomal proteins
  Proteins found in most exosomes
   656193 (Chc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG6
AA seq 1684 aa AA seqDB search
MTQQLLPIKFQEHLQLTNVGINVANISFATLTMESDKFICVREKVGDTSQVVIIDMGDTA
NPIRRPITAESAIMNPASKVIALKGKAGVEAQKTLQIFNIEMKSKMKAHTMSEDVIFWKW
ISLNTLALVTETSVYHWSMEGDSTPVKMFDRHSSLNGCQIINYRTDPKQNWLLLVGISAQ
QSRVVGAMQLYSVERKCSQPIEGHAASFATFKMEGNPEPSTLFCFAVRTVQGGKLHIIEV
GQSPAGNQPFPKKTVDVFFPPEAQNDFPVAMQVSAKYDVIYLITKYGYIHMYDIESAICI
YMNRISSETIFVTAPHESTGGIIGVNRRGQVLSVSVDEDSIIRYVNQVLHNPDLALRIAT
RNNLAGAEELFVNKFQMLFTNGQYAEAAKVAANAPKGILRTPATIQMFQQVPTQPGQNSP
LLQYFGILLDQGQLNRYESLELCKPVLLQGRKQLLEKWLKEDKLECSEELGDLVKQADST
LALSVYLRANVPAKVIQSFAETGQFQKIVLYAKKVNYTPDYIYLLRSVMRTNPDQGAAFA
SMLVADEEPLADINQIVDIFMEQNMVQQCTAFLLDALKHNRPTEGHLQTRLLEMNLMSAP
QVADAILGNNMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLPMDWLVN
FFGTLSVEDSLECLKAMLTANIRQNLQICVQIATKYHEQLTTKALIDLFESFKSYEGLFY
FLGSIVNFSQDPDVHFKYIQAACKTGQIKEVERICRESNCYNPESVKNFLKEAKLTDQLP
LIIVCDRFDFVHDLVLYLYRNSLQKYIEIYVQKVNPSRLPVVVGGLLDVDCAEDIIKNLI
LVVRGQFSTDELVEEVEKRNRLKLLLPWLESRVHEGCVEPATHNALAKIYIDSNNNAERF
LKENQWYDSRVVGRYCEKRDPHLACVAYERGQCDRELIAVCNENSLFKSEARYLVRRRDP
ELWAEVLQESNPYRRQLIDQVVQTALSETQDPEDISVTVKAFMTADLPNELIELLEKIVL
DSSVFSDHRNLQNLLILTAIKADATRVMDYINRLDNYDAPDIANIAINNHLYEEAFAIFK
KFDVNTSAIQVLIEQVNNLDRAYEFAERCNEPAVWSQLAKAQLNQGLVKEAIDSYIKADD
PSAYMAVVETASKNNSWEDLVRYLQMARKKSRESYIESELIYSYAKTGRLADLEEFISGP
NHADIQKIGDRCFDDKMYDAAKLLYNNVSNFARLAITLVHLKEFQGAVDSARKANSTRTW
KEVCFACVDAEEFRLAQMCGMHIVVHADELQDLINYYQDRGYFEELIGLLEAALGLERAH
MGMFTELAILYSKYKPAKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDN
AVLAMMAHPTEAWREGHFKDIITKVANIELYYKAIQFYLDYKPLLLNDLLLVLAPRMDHT
RAVAFFTKTGHLQLVKSYLRSVQNLNNKAINEALNSLLIEEEDFQGLRTSIDAFDNFDNI
GLAQKLEKHELTEFRRIAAYLYKGNNRWKQSVELCKKDRLFRDAMEYTAESKNQELAEEL
LAWFLERKAYDCFAACLYQCYDLLRPDVILELAWRHKIMDLAMPYLIQVTRELTTKVEKL
EQSDAQRQSEAAEETHKPMMINEPQLMLTAGPGMGIPPQAYVPPQAYAQPGYAPQMPYGA
YPGM
NT seq 5055 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaacaattactcccgataaagttccaggagcacttgcagctcacaaatgtcggg
attaacgtggccaacatctccttcgccactctcaccatggagagcgacaagttcatctgc
gtgcgggagaaggtcggggacacgtcccaggtggtcatcatcgacatgggggacaccgcc
aaccccatcagacgccccatcaccgccgagagcgcgatcatgaaccccgcctccaaagtg
atagccctcaagggcaaagcgggcgtcgaggcccaaaagaccttgcagattttcaacatc
gagatgaagtccaaaatgaaagcacacaccatgtcagaggacgtcatcttctggaagtgg
atctcgctaaacaccttggctttggtcaccgaaacctcggtgtatcattggtccatggag
ggtgactctacacctgttaaaatgtttgatcgtcactcatctctgaatggctgccaaatt
ataaactatcgcactgatcccaaacaaaactggttactattggtgggcattagtgcccaa
cagtctcgtgttgtgggcgcaatgcaactttattccgtcgaaagaaaatgttcacaaccg
atcgaaggtcatgctgcctcttttgccacattcaaaatggaaggcaatcctgaaccatcg
acacttttctgctttgccgtaagaacagtacaaggaggcaaactccacatcatcgaagtg
gggcaaagtccggccggcaaccaaccattccccaagaaaaccgtcgacgtgttcttcccc
cctgaggcccaaaacgactttcccgtagcgatgcaagtctcggcaaaatacgacgtcatc
tacttaatcacaaaatacggctacattcacatgtacgacatcgaaagcgccatctgtatc
tacatgaatcgtatctcaagcgagacaattttcgtaacagctccgcacgaatccaccggt
ggtattatcggtgtgaatcgtcgcggacaagtattgtctgtttctgtcgacgaagacagt
attattcgatatgtgaatcaagttttgcacaatcctgatctggctttacgtatcgccact
agaaataatctcgcaggcgctgaagagctgtttgtgaacaagttccaaatgttgttcacg
aatggacagtatgctgaagcggccaaagtggcagccaatgcgccgaaagggattttgaga
acaccagctacgattcaaatgttccaacaagtgcccacgcagccgggacagaacagtcca
ctgttgcagtatttcgggattttgttagatcaagggcagctaaacagatacgaatcgttg
gaattgtgcaaaccagtcctcttgcaaggccgtaaacaacttctcgaaaaatggctaaaa
gaagacaaactcgaatgttcggaagaattgggcgatctcgtaaaacaagccgactcaact
ctcgccctttctgtctatctccgagctaacgtccccgccaaagtcattcaaagttttgcc
gaaaccggtcagttccaaaaaatcgtcctctacgccaaaaaagtcaactacacacccgac
tacatttacttgctgcgctccgtcatgcggacaaaccccgaccagggggcggctttcgca
agcatgctggttgccgacgaggaaccactagccgacatcaaccaaattgtcgatattttc
atggaacaaaacatggtgcaacagtgcacggccttcttgctggacgctttgaagcacaat
aggccgaccgaaggccacctccagacgcgcctcctggagatgaacttaatgtcggcgccg
caggtcgccgacgcaatcctgggcaacaacatgtttacgcattatgacagagcccatatt
gcgcagctttgcgagaaagccgggctgttgcagagggcgctggagcactacaccgacttg
tacgacatcaagcgggctgtggtccacacccacttgctgccaatggattggctggtgaat
ttcttcgggactttgagcgttgaggacagtttggagtgtctcaaggctatgttgacggcc
aatataaggcaaaacttgcagatttgtgtacaaattgcgaccaaatatcacgaacaactt
acaacgaaagcgctgattgatttgtttgagagttttaagagttatgaagggcttttctat
tttctgggttcgattgtgaatttttcacaggatccggatgtgcatttcaagtatattcag
gcggcgtgtaagaccggacaaatcaaggaagttgaacggatttgtcgagagtcgaattgt
tataatccggagagtgtgaagaatttcctcaaggaagcgaaactgaccgatcaattgccg
ttgattattgtgtgcgatcgcttcgatttcgtgcacgatttggtgctgtatttgtacagg
aattcgctgcaaaagtacatcgagatctacgtacaaaaggtaaatcccagccgtctcccc
gtggtcgtcggcggcctcctggacgtagactgcgccgaagacatcatcaaaaacctgatc
ctcgtcgtccgtggccaattctccaccgacgaactggtcgaagaagtggagaaacgcaac
cgcttgaaactcctcctaccatggctggagagtcgcgtccacgagggctgtgtcgaaccg
gccacccacaacgccctggccaaaatctacatcgattcaaacaacaacgccgaacgtttc
ctcaaagaaaaccaatggtacgactcacgcgtcgttggccgctactgcgaaaaacgcgac
ccccatctcgcctgcgtcgcctacgagcgcggccaatgcgaccgcgaactaatcgcagtc
tgtaacgaaaactcgcttttcaaatccgaggcgagatatttagtcagacggcgggacccg
gaattatgggccgaagtcttgcaggaaagtaacccgtacaggagacaattgatcgatcaa
gtggtccagacagcgctgagcgaaacgcaagacccggaggacatctccgtgactgtcaaa
gccttcatgactgctgaccttccaaatgaattgatcgagttgcttgagaaaatcgtcctg
gacagttcggttttctccgatcaccgaaacttgcaaaacctcctgatcctaacggcgatc
aaagccgatgccacccgagtcatggactacatcaaccgtctagataattacgacgctcct
gatatcgcaaatatcgcaataaataaccatttatacgaggaggcgtttgcaattttcaag
aaattcgacgttaacacttcagccattcaggttctgatcgagcaggtgaacaatttggat
cgtgcgtatgagtttgcggagcgttgtaatgagccggcggtttggagtcagttggccaag
gctcagttgaatcaagggttggtcaaggaggcgatcgattcgtacattaaggccgatgat
ccgtcggcctatatggccgtggtggagacggcgtccaagaataactcgtgggaggatttg
gtgcggtatttgcaaatggcgaggaagaagtcacgggagagttatatcgagtcggagttg
atttattcgtatgccaagacgggacggcttgccgatttggaggagtttataagtgggccg
aatcatgccgatatacagaagatcggcgatcgatgttttgatgataaaatgtacgatgcg
gccaagttgttgtataataatgtctcgaattttgcgaggttggcgattactttggtgcat
ttgaaggagtttcagggagctgtcgacagcgcccgcaaggccaacagcacccgcacctgg
aaagaggtatgttttgcgtgcgtggacgccgaagagttccgtttggcgcaaatgtgcgga
atgcacattgtcgtccacgccgacgaactgcaagatctcatcaactactaccaagaccgc
ggctatttcgaagagctcatcggtctgctggaggccgccctaggtctcgagcgcgcccac
atgggcatgttcaccgagctggccatcctctattcgaaatacaagccggcgaaaatgcgc
gaacacctggagctgttctggtcgcgcgtcaacattcccaaagtattgcgcgccgccgaa
caggcgcatctctgggccgaactggtctttctctacgataagtacgaggagtacgataat
gccgttttggccatgatggcgcatccgacggaggcatggcgtgaaggacactttaaagat
attatcactaaagtggccaatattgagttgtactacaaggcgattcagttttatttggat
tataagccgttgttgttgaacgatttgttgctggttttggcaccgagaatggatcatacg
agggctgtggcgtttttcacaaagacgggacatttacaacttgtcaagtcttacttgagg
tcggtgcagaatttgaataataaggccattaatgaggcgctaaattcgctattgattgaa
gaagaggatttccagggtttgagaacatcgatcgacgcattcgacaatttcgacaatatc
ggcttggcccaaaaactcgaaaaacacgaactgaccgaattcagacgcatcgccgcctat
ttatacaaaggcaacaacagatggaaacagagcgtggaattatgtaagaaggatcgcctt
ttcagagatgcgatggaatacacagctgaatccaaaaatcaagaattggccgaagaacta
ctggcgtggtttttggaacgaaaggcctatgattgttttgcagcatgtctctaccaatgc
tatgatttattaaggcctgacgtaatattggaactagcctggagacataaaatcatggat
ttggcgatgccttatttgattcaagtaacgagagaattgaccacaaaagtggaaaaattg
gaacaatcggatgcacaaaggcagagcgaggccgccgaagaaacacacaagccgatgatg
atcaacgagccacagctaatgctaacggcaggacctggcatgggtattccaccgcaggcg
tacgtccccccgcaggcctacgcccagcccggctacgccccccagatgccgtacggcgct
tacccgggcatgtaa

DBGET integrated database retrieval system