KEGG   Tribolium castaneum (red flour beetle): 656223Help
Entry
656223            CDS       T01046                                 

Definition
OTU domain-containing protein 5-A
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     656223
Peptidases [BR:tca01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   656223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG1=X
AA seq 556 aa AA seqDB search
MTILPAKRPSANPEEKSDNSQQNGNSERAVRRRDDISSLNEASPSSRRSQFPYVKSTTER
KERLRKRYKEPDRARDREREREQKREVRREQKRERVAKRDISNEPLHDNNASNSVVDSVA
VEPTCNNNEPGTANKEDYTGFNSEDEYDDQGLLKERNIPDEEWQKRDVLFSRGMSNLGFE
IKQMNEDGACLFRSIADQVYGDQEFHYQVRQDCMNYIVQNRDYFEPYVTEDFDKYVARKR
IWNVHGNHLEIQAMSELYNRTIEVYCYQITPINIFNGSRLINSYEPIRLSYHRMCHYNSI
SNPNKPSVGVGLGLPNYHTVDIDRRRFNDALRASDELLIEQTMLEDKLKATDFEATNEAI
EEQVARESYIQYFRDSERRLKNQGHSCGSSSTITSATMSSSRSSRKGSVSPKGSQSPKGS
NSPKTTPLASPRGAGAPSPSTSRYEADVSGGDVAGACGGPPEEFPKFSPRRSEPPAEDVN
NPDYDENFNEDFKFDFDSDSDQSAGAGPSNRGDIDYDNYDQEIMAQVLAESRKTYLAELK
QRSKKRHGSPGPSTSS
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgacaattttaccagccaaaagaccttcggcgaatccggaggagaaaagcgacaatagt
cagcaaaatgggaattccgagcgagcggtgcgtaggagagacgatataagttctctgaat
gaggcaagcccttcaagccgccgatctcagttcccctacgtcaagtcaacaactgagcgg
aaagagcgtttgaggaagcgatataaagagccagatcgggcgcgagatagggaacgcgag
cgcgaacaaaaacgggaagttcggagggaacaaaaacgggaacgagttgctaaacgcgat
atctcaaatgagcctctacatgacaataatgcgagtaattcggttgttgactcagtcgct
gttgagcccacttgcaacaacaacgaacctgggactgcgaacaaggaagactacacgggc
ttcaacagcgaggatgagtacgatgaccagggactcctcaaagagcggaacataccggat
gaagagtggcaaaaaagggacgtgttattttcccgcggcatgtccaaccttgggttcgaa
atcaagcaaatgaacgaagatggggcctgtctcttccggtcgatagcagaccaagtgtac
ggcgaccaagaattccattatcaagtcaggcaggactgcatgaactacatcgttcaaaac
cgtgactactttgaaccttacgtgacggaggattttgataaatacgttgcacggaaacgt
atatggaacgtacatggcaaccatttagaaatacaagcaatgagcgagttatataatagg
acaatcgaagtttattgctaccaaataacaccaatcaatatattcaatggttcaagatta
attaactcatatgagcctattagattatcataccacaggatgtgtcattataattctatt
agtaacccaaataaaccttcagtaggggtaggcttaggtttacccaattaccataccgtt
gatattgacagaagaaggttcaatgacgctctgcgggctagtgatgagttgctaattgaa
cagactatgctagaagacaagttgaaagcaaccgactttgaagccaccaacgaagccatc
gaagaacaggtagctcgcgagtcctacatccaatattttcgcgactcagaacgccgtttg
aagaaccaaggacactcctgtggtagcagttcaacgataacatcagcaaccatgtccagc
tcgcgctcgtcgaggaaaggctcggtctccccgaagggatcgcagtcccccaaagggtcc
aactcgccaaagacaacaccactagcgagcccccgaggcgctggggcgccgtccccatcg
actagccgctatgaggccgacgtcagcgggggcgatgtggcgggagcctgcggtggacca
ccggaggaatttccgaaattttcgccgcgccgttctgagcccccggccgaggatgttaat
aacccggactatgatgaaaatttcaacgaggactttaaatttgattttgattccgattcg
gatcagtcggctggggccgggccatcaaaccgcggtgatatagattacgacaattatgac
caggaaatcatggcccaagtgctggccgagtcgcgcaaaacttacttagctgaacttaag
cagcgatccaagaagcgtcatggatctccgggaccatccacttcatcctag

DBGET integrated database retrieval system