KEGG   Tribolium castaneum (red flour beetle): 656248Help
Entry
656248            CDS       T01046                                 

Definition
similar to CG7995-PA, isoform A
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    656248
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     656248
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   656248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG3
AA seq 517 aa AA seqDB search
MVSSDEVPLIGVIDAGTRTVQFCVFRSQHTQEIAGHAIDITQHTPQEGWFEEDPNEILQA
VKTCMKNVVSQIGDKACKNIVTIGITNQRETTVVWDKTTGQPLCNAIVWNDIRTDSTVDI
ILAKVPENNKNYFKPLCGLPISPYFSAFKLKWLMHHVPEVKKAIKAKKCLFGTVDTWLLW
NLTGGPNGGLHITDVTNASRTFLMNIETFHWDPLLLHTFKIPEEILPEIRSSSEIYGKIC
GKDFPLQEVPISGRVQSSHGLVTTVAYKFGDSPPVYALEGSVAVAGSALSWLRDNMGFLK
DVHQDTEHLAKEVFNTGDVYFVPAFTGLYAPYWRKDARGIICGLTAFSTKQHIIRAALEA
ICFQTRDILEAMNKDCGIPLTKLNVDGRLTRNDLLMQLQADISGIPVIRAQSQDITALGV
AIAAGQAKGIEVWDLNAEDREVIPSDTFLPTTTEDERDSRYTKWKMAVQRSLGWAVPKKT
FTMTEERYRLLASIPGSLYIIGSFGLLALSEYLARAS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggtttcttcagatgaggtgcccctaattggagtgatagacgccggcactaggacagtc
cagttttgtgtttttcgcagtcagcacactcaggaaatcgcgggacatgccatagatata
actcaacatacgcctcaggaagggtggtttgaagaagaccccaatgagattcttcaggcg
gtgaaaacctgcatgaagaacgttgtgagccagataggagataaagcctgtaaaaacatt
gtcactatcggaattaccaaccagcgggaaacgacagttgtttgggataaaacaacagga
cagcctttatgtaacgcaatcgtttggaacgatatcaggacggactccaccgtcgacata
attctagcaaaagtacctgaaaacaataaaaactactttaagccactttgcggacttcca
atctcgccgtatttcagcgcgtttaagttgaaatggcttatgcaccacgtgcctgaagta
aagaaagcgataaaggcgaaaaagtgcctttttggcaccgttgacacctggttattatgg
aacctaacggggggtccaaacggtggactgcacatcacagacgtcacaaacgcctcaaga
acattcctaatgaatatagagacttttcactgggatccgctgcttttgcacactttcaaa
attccggaagaaatactcccggaaattcggagcagttcggaaatttatggaaaaatttgc
ggaaaagactttcctctgcaagaagtgccgatttcagggagagtacaatcgagtcatggc
ttggtcacgaccgttgcgtacaaattcggcgattctccgcctgtttatgccttagaaggt
agcgttgctgtggccggttcggccttatcttggctccgagacaatatgggttttttaaaa
gacgtccaccaagacaccgaacacctcgccaaagaagtgttcaacacgggggatgtttat
tttgtccctgccttcacgggtctttatgcaccttactggcggaaagatgctagagggata
atatgcgggttgactgccttttccacgaagcaacacatcatccgagcggcattagaggcg
atctgtttccaaactagggatattttagaagccatgaataaagattgcggtattccatta
acgaagttaaacgtggacgggagattaacaagaaacgatttattgatgcagttacaagct
gatattagtgggattcccgtaattcgggctcagagtcaggatattacggctttgggagtc
gctattgcggctggacaagcaaaagggatcgaggtctgggatttgaatgctgaagaccgt
gaggttattcctagtgatacattcctcccaacaaccacagaagatgaaagggactcgagg
tacaccaagtggaagatggccgtccagaggtcgctaggttgggccgttccgaagaaaaca
ttcaccatgaccgaggaaagataccgacttttggctagcattccagggagtttatacatt
atcgggagttttggccttttggccttgtcagaatatctcgcaagagcaagttaa

DBGET integrated database retrieval system