KEGG   Tribolium castaneum (red flour beetle): 656290Help
Entry
656290            CDS       T01046                                 

Definition
(RefSeq) 2-hydroxyacylsphingosine 1-beta-galactosyltransferase-like
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    656290
   00053 Ascorbate and aldarate metabolism
    656290
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    656290
   00860 Porphyrin and chlorophyll metabolism
    656290
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    656290
   00982 Drug metabolism - cytochrome P450
    656290
   00983 Drug metabolism - other enzymes
    656290
Enzymes [BR:tca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     656290
Glycosyltransferases [BR:tca01003]
 Others
  Hydrophobic molecule
   656290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
LG9
AA seq 519 aa AA seqDB search
MKLTLSLLVFVLISTVNSAKILGVFPVPGRSHYILASSLMRALAEKGHDVTVISCFGEKI
PPKNGTYRDIVATGVFDEMQKEMNSKNMSMFEIGGASPLLNAFFMAVLLPEMTEKALKHE
NVQKFINSDEKFDVVIVEQFANDAQKALSTHFGAPLITFSTLGANYWVNPLVGNPSPPSY
IPDLMSDYSVPMTFVERLENSLVYVMNELLYNFYIFPKQNELMKKYIPRAPAHINDVLYN
SSIILMNAHPSINQPVPYVPNMVDIGGFHVKPPKKLPQDLQEFLDGAKDGVIYFSMGSNL
KSADLPNDKRDAILKTFAKLKQKILWKWEDENLPGKPPNVKTAKWLPQQDILAHPNVKLF
ITHGGLLSTTETIYHGVPILAVPIFGDQKLNARSAVKGGYGVHLPYEELNEETLTNSINE
VLSNKKYKENVQKRSKLFHDRLVSPIDTLTYWVEYVVRHRGAPHLRVAALDLPWYKYLLL
DVIAVIALVLLTLLLIFCYVVKLVCKKLCSKKSKKTKKE
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttacattatctctactagtgtttgtgttaatttcaaccgtaaatagtgccaaa
attctgggtgttttccccgtgcctggccgcagccactacatccttgccagttctcttatg
cgagcccttgctgaaaaagggcacgacgttacggtcattagctgtttcggcgaaaaaatt
cccccgaaaaatggaacctacagagacattgtggcgactggagttttcgacgaaatgcaa
aaggaaatgaactcgaaaaacatgtccatgttcgaaatcgggggcgcaagccccctactt
aatgcttttttcatggcagttctgttgcccgaaatgaccgaaaaggctctaaagcacgaa
aatgtccaaaaattcataaactcagacgagaagtttgatgttgtgattgtggagcagttt
gcaaatgatgcacaaaaggccttatcgacgcattttggcgccccgttgatcactttcagt
acactgggggccaattattgggtaaatcccctagttggaaacccctccccgccttcttat
atcccggatctgatgtcggactattcagttccaatgacatttgtcgaaagattggaaaat
agtcttgtgtacgttatgaacgagctgctgtacaatttttacatttttccgaaacaaaac
gaactcatgaaaaagtacatcccaagggccccagctcacatcaatgacgtgctttacaac
agttctattattttaatgaacgcgcaccccagtatcaaccaacctgtcccatatgtgccc
aacatggtcgatatcggaggctttcacgtcaaaccccccaaaaaactaccccaagactta
caagaatttttagatggtgccaaagacggtgttatttacttcagcatgggttctaatcta
aaaagtgccgatttgccaaacgacaaacgcgacgcaattcttaaaacgttcgcaaaattg
aaacaaaaaattttgtggaagtgggaagacgaaaatttgccgggaaaaccaccaaacgtt
aaaaccgccaaatggttaccccaacaagacattcttgcacacccgaatgttaaacttttt
ataacccatggtggtcttctaagcaccactgaaaccatctaccacggagtgcccattctg
gcagtacctattttcggtgaccagaaattgaacgcaaggtctgcggtcaagggtgggtat
ggagttcatctgccttatgaagaactgaacgaagaaactttaactaacagtattaacgaa
gttttaagtaacaagaagtacaaagaaaatgttcaaaaacggtcgaaactcttccacgac
cgtctagttagccctattgacactcttacttactgggttgagtatgttgttagacataga
ggggcacctcatttgagagttgcagccttggacctgccttggtacaaatatttgttatta
gatgttattgcagtaattgctttagtgctattaactttgttgcttattttctgttacgtt
gtaaaattagtttgcaagaaattgtgttcaaagaagagtaagaaaacgaagaaagaataa

DBGET integrated database retrieval system