KEGG   Tribolium castaneum (red flour beetle): 656290Help
Entry
656290            CDS       T01046                                 

Definition
2-hydroxyacylsphingosine 1-beta-galactosyltransferase-like
Organism
tca  Tribolium castaneum (red flour beetle)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG9
AA seq 519 aa AA seqDB search
MKLTLSLLVFVLISTVNSAKILGVFPVPGRSHYILASSLMRALAEKGHDVTVISCFGEKI
PPKNGTYRDIVATGVFDEMQKEMNSKNMSMFEIGGASPLLNAFFMAVLLPEMTEKALKHE
NVQKFINSDEKFDVVIVEQFANDAQKALSTHFGAPLITFSTLGANYWVNPLVGNPSPPSY
IPDLMSDYSVPMTFVERLENSLVYVMNELLYNFYIFPKQNELMKKYIPRAPAHINDVLYN
SSIILMNAHPSINQPVPYVPNMVDIGGFHVKPPKKLPQDLQEFLDGAKDGVIYFSMGSNL
KSADLPNDKRDAILKTFAKLKQKILWKWEDENLPGKPPNVKTAKWLPQQDILAHPNVKLF
ITHGGLLSTTETIYHGVPILAVPIFGDQKLNARSAVKGGYGVHLPYEELNEETLTNSINE
VLSNKKYKENVQKRSKLFHDRLVSPIDTLTYWVEYVVRHRGAPHLRVAALDLPWYKYLLL
DVIAVIALVLLTLLLIFCYVVKLVCKKLCSKKSKKTKKE
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttacattatctctactagtgtttgtgttaatttcaaccgtaaatagtgccaaa
attctgggtgttttccccgtgcctggccgcagccactacatccttgccagttctcttatg
cgagcccttgctgaaaaagggcacgacgttacggtcattagctgtttcggcgaaaaaatt
cccccgaaaaatggaacctacagagacattgtggcgactggagttttcgacgaaatgcaa
aaggaaatgaactcgaaaaacatgtccatgttcgaaatcgggggcgcaagccccctactt
aatgcttttttcatggcagttctgttgcccgaaatgaccgaaaaggctctaaagcacgaa
aatgtccaaaaattcataaactcagacgagaagtttgatgttgtgattgtggagcagttt
gcaaatgatgcacaaaaggccttatcgacgcattttggcgccccgttgatcactttcagt
acactgggggccaattattgggtaaatcccctagttggaaacccctccccgccttcttat
atcccggatctgatgtcggactattcagttccaatgacatttgtcgaaagattggaaaat
agtcttgtgtacgttatgaacgagctgctgtacaatttttacatttttccgaaacaaaac
gaactcatgaaaaagtacatcccaagggccccagctcacatcaatgacgtgctttacaac
agttctattattttaatgaacgcgcaccccagtatcaaccaacctgtcccatatgtgccc
aacatggtcgatatcggaggctttcacgtcaaaccccccaaaaaactaccccaagactta
caagaatttttagatggtgccaaagacggtgttatttacttcagcatgggttctaatcta
aaaagtgccgatttgccaaacgacaaacgcgacgcaattcttaaaacgttcgcaaaattg
aaacaaaaaattttgtggaagtgggaagacgaaaatttgccgggaaaaccaccaaacgtt
aaaaccgccaaatggttaccccaacaagacattcttgcacacccgaatgttaaacttttt
ataacccatggtggtcttctaagcaccactgaaaccatctaccacggagtgcccattctg
gcagtacctattttcggtgaccagaaattgaacgcaaggtctgcggtcaagggtgggtat
ggagttcatctgccttatgaagaactgaacgaagaaactttaactaacagtattaacgaa
gttttaagtaacaagaagtacaaagaaaatgttcaaaaacggtcgaaactcttccacgac
cgtctagttagccctattgacactcttacttactgggttgagtatgttgttagacataga
ggggcacctcatttgagagttgcagccttggacctgccttggtacaaatatttgttatta
gatgttattgcagtaattgctttagtgctattaactttgttgcttattttctgttacgtt
gtaaaattagtttgcaagaaattgtgttcaaagaagagtaagaaaacgaagaaagaataa

DBGET integrated database retrieval system