KEGG   Tribolium castaneum (red flour beetle): 656335Help
Entry
656335            CDS       T01046                                 

Definition
probable DNA-3-methyladenine glycosylase
Orthology
K03652  
DNA-3-methyladenine glycosylase [EC:3.2.2.21]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    656335
Enzymes [BR:tca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     656335
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG3
AA seq 224 aa AA seqDB search
MSQAARRLTKADLHLPCKRQAVYLLGKILARRLDDGSVLRGRIVEDECYLGGEDKASHSY
NGRQTAGNEPMYMPAGTTYVYFIYGMYCCFNISSLEPGAAVLLRALEPIQGQEQMGKLRA
AKQKSPLKSPLKEKDLCNGPSKLCMSFNITKNNCNKIDLTESEVLWLEDDGFEVEKKDIV
TCKRVGIGSAGEEWVGKPLRFYVLGNPHVSKRDKKTEKKMSESD
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagcagcccggaggcttacaaaggccgacttgcacttgccttgcaagcggcag
gcggtttaccttttgggcaagattttggcccgaaggctcgacgacggttcagttctcaga
ggcaggattgttgaagacgagtgttatctagggggcgaagacaaggcctcgcattcgtac
aacgggcgccagacggccgggaacgaacccatgtatatgcccgcgggaacgacttacgtt
tacttcatttatggaatgtattgttgcttcaatatttcgagtcttgagccaggcgctgcg
gttctacttagggcccttgaaccgattcaaggccaggaacaaatggggaaattacgagca
gctaagcaaaaaagtccgttgaaaagtcctttaaaagaaaaggatttgtgtaatgggccc
tccaagttgtgtatgtcgttcaatattacaaaaaataactgcaataagattgatctgact
gaaagtgaggtgttgtggctggaagacgatgggtttgaagtggagaaaaaagacattgtg
acgtgtaaaagggttggtattgggtcggcgggcgaggaatgggtgggaaagccgttgagg
ttttacgttttgggtaatcctcatgttagcaaaagggataaaaagacagagaagaaaatg
tccgagtctgattaa

DBGET integrated database retrieval system