KEGG   Tribolium castaneum (red flour beetle): 656335Help
Entry
656335            CDS       T01046                                 

Definition
N-methylpurine-DNA glycosylase-like
Orthology
K03652  
DNA-3-methyladenine glycosylase [EC:3.2.2.21]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:tca03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG3
AA seq 224 aa AA seqDB search
MSQAARRLTKADLHLPCKRQAVYLLGKILARRLDDGSVLRGRIVEDECYLGGEDKASHSY
NGRQTAGNEPMYMPAGTTYVYFIYGMYCCFNISSLEPGAAVLLRALEPIQGQEQMGKLRA
AKQKSPLKSPLKEKDLCNGPSKLCMSFNITKNNCNKIDLTESEVLWLEDDGFEVEKKDIV
TCKRVGIGSAGEEWVGKPLRFYVLGNPHVSKRDKKTEKKMSESD
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagcagcccggaggcttacaaaggccgacttgcacttgccttgcaagcggcag
gcggtttaccttttgggcaagattttggcccgaaggctcgacgacggttcagttctcaga
ggcaggattgttgaagacgagtgttatctagggggcgaagacaaggcctcgcattcgtac
aacgggcgccagacggccgggaacgaacccatgtatatgcccgcgggaacgacttacgtt
tacttcatttatggaatgtattgttgcttcaatatttcgagtcttgagccaggcgctgcg
gttctacttagggcccttgaaccgattcaaggccaggaacaaatggggaaattacgagca
gctaagcaaaaaagtccgttgaaaagtcctttaaaagaaaaggatttgtgtaatgggccc
tccaagttgtgtatgtcgttcaatattacaaaaaataactgcaataagattgatctgact
gaaagtgaggtgttgtggctggaagacgatgggtttgaagtggagaaaaaagacattgtg
acgtgtaaaagggttggtattgggtcggcgggcgaggaatgggtgggaaagccgttgagg
ttttacgttttgggtaatcctcatgttagcaaaagggataaaaagacagagaagaaaatg
tccgagtctgattaa

DBGET integrated database retrieval system