KEGG   Tribolium castaneum (red flour beetle): 656399Help
Entry
656399            CDS       T01046                                 

Definition
elongation protein 3 homolog-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
tca  Tribolium castaneum (red flour beetle)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEETLEBASE: 
UniProt: 
Position
LGUn
AA seq 591 aa AA seqDB search
MGKKRNEFSHITVEEKKVITVAEIVQLLIKAQDEKRDVNLNALKARISAKYGLGTSPRLV
DIIAAVPMNYRKTLVPKLLAKPIRTASGIAVVAVMCKPHRCPHINMTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMSLP
EDYRDYFIRNLHDALSGHKSSSVEEAVKYSERSNTKCIGITIETRPDYCLQKHLSDMLKY
GCTRLEIGVQSVYEDVARDTNRGHTVKAVCETFNLAKDAGYKVVSHMMPDLPNVDLERDI
EQFIEFFENPNFRADGLKIYPTLVIRGTGLYELWKTGRYKSYPPSILVDLIANILALVPP
WTRVYRVQRDIPMPLVSSGVEHGNLRELALQRMKDLGLRCRDVRTREVGITEIHEKVRPN
DVELIRRDYYANGGWETFLSYEDPEQDILIGLLRLRKCSKATTYRPELLGECSIVRELHV
YGSVVPVSGRNIKKFQHQGYGTLLMQKAEDIAIKEHKSVKIAVISGVGTRNYYRKLGYEL
EGPYMVKSLKPEFYKSVFSCVDGEPLHKTTEYYERKKWTLDDSEWLEQFDK
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaaacgaaacgaattttcccatattactgttgaagagaaaaaagtaataaca
gtggctgaaattgtgcaattgctcataaaagcccaagatgaaaaacgcgacgttaatctt
aacgctctcaaggcgcgaatttcggcaaaatatgggcttgggacttcgccccgtcttgtt
gacattatagccgcagttccgatgaactatcgcaagactttagtaccgaaactattagct
aaaccgatcaggactgccagtgggattgcagttgtggcagtgatgtgtaagccgcacaga
tgcccccatattaacatgactggcaatatttgtgtatattgtcccggtggtcccgattct
gatttcgaatattcgactcagagttacacaggctatgaaccaacgtcaatgagggccata
agggccagatatgatccctatttacaaactagacacagagtcgagcaattgaaacaatta
ggacattctgtagataaagttgaatttattgtgatggggggcacgtttatgagccttccg
gaggactacagggattatttcattagaaatttgcacgatgctttatctggacataaaagt
agttcagttgaggaagctgtcaagtattctgaaagatccaacactaagtgtattggaatt
acgattgagacaaggccggattattgcttgcaaaagcatttgtctgatatgttgaaatat
gggtgtacaaggcttgaaataggtgtccagtcggtttatgaagacgtggccagggatacc
aaccgtggtcacactgttaaagcagtttgtgaaacatttaatttagctaaggatgcaggc
tataaagtggtatcacatatgatgcctgatttgccaaatgttgatctagagcgtgacatt
gagcagtttattgagtttttcgaaaatccgaattttagagctgacggtttgaaaatttat
cctactttggtaattcgagggactggtctctacgaattgtggaaaaccggacgttataag
agttatcctccttcgattcttgttgatttgattgcaaatattttggctttggtgccgcct
tggaccagggtgtatagagtgcaacgcgatatacccatgcctcttgttagttcaggggtc
gagcatggaaacctccgcgaattagccctccaaagaatgaaagatctaggtctgagatgt
cgtgacgtgcgaactcgcgaagtcggaataacagaaatccatgaaaaagtgcgccccaac
gatgttgaattaattagaagagattattacgcaaatggaggttgggagacgttcttaagt
tacgaagatcccgaacaagacattctaatcggcctcttacgtttgcgtaaatgctccaaa
gcaacgacttatcgtcccgaacttttgggtgaatgttcaatagttcgtgaacttcacgtt
tatggaagtgtggttcctgtgagtggtcgtaacattaagaaattccaacatcaaggttat
ggcactctcctaatgcaaaaagccgaagatattgcaataaaagagcacaaatctgttaaa
attgcggttatttctggagtcgggactaggaattattacagaaaattggggtacgagctt
gaggggccttacatggtcaagtcactaaagccagaattttacaaaagtgtcttcagttgt
gttgatggtgagccattgcataaaactacagagtattatgaacgaaaaaagtggacgctt
gatgatagtgaatggttggagcagtttgataaataa

DBGET integrated database retrieval system