KEGG   Tribolium castaneum (red flour beetle): 656478Help
Entry
656478            CDS       T01046                                 

Definition
similar to acyl-CoA desaturase HassGATD
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:tca01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:tca01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LGUn
AA seq 331 aa AA seqDB search
MYYRKWQIVWRNVLIFIYLHIAGIYGLYYAIAQAQWKTLLWASGIGVTAGAHRLWAHRTY
KAKLPLRIYLAFCQTVALQNDIYEWVRDHRVHHKFTDTDADPHNSNRGFFFSHMGWLLVK
KHKDVFVKGKTVDMSDVEADPVVRFQRKYYIILTPILTFVFPAIVPWYFWNETPTVCFYS
VAIFRYILTLHGTWLVNSAAHIWGYRPYDKNINATENKSVSILAFGEGWHNYHHVFPWDY
KAAELGNYRMNFTTAFLDLMSKIGQAYDLKTVSVDMINKRRKRTGDGTGLVDEELLENED
KHHHHHDDSIWGWGDKDMKQDDMDMVQVHNP
NT seq 994 nt NT seq  +upstreamnt  +downstreamnt
atgtactaccgcaaatggcagattgtatggagaaacgttttgatatttatatacttgcac
attgctggtatttatggattatattatgctattgctcaagcgcaatggaaaactcttctc
tgggcatcaggaattggcgtaacagcaggagcgcacagactgtgggcccatcgcacatac
aaagctaaacttccattacgaatttacttagctttttgtcaaactgttgctttacaaaat
gacatctacgaatgggtgcgagaccatcgagttcatcacaaattcacagatacagacgct
gatcctcacaactctaatcgaggattctttttctcacacatgggatggttattggttaaa
aaacacaaggatgttttcgtcaagggcaaaactgtggatatgagtgatgtggaagccgat
ccggtggtacggtttcaaagaaaatactacataattctaactccaattttaacatttgtt
tttcctgctatcgttccttggtacttctggaacgaaactcccactgtttgcttctatagt
gtcgccatctttagatatattctcacacttcatgggacttggctggtaaatagtgcagct
catatttggggctatagaccctatgacaaaaacataaatgccacagaaaacaaaagcgtt
tcaattctcgctttcggtgaaggatggcacaactatcatcatgtcttcccttgggattac
aaagccgcagaattaggaaactacaggatgaattttactacggcttttctggatttgatg
tcaaaaattggacaggcttatgatttgaaaaccgtgtcagttgatatgatcaataagaga
agaaagagaactggagatggtactggattggttgacgaggaattgctagaaaatgaagat
aaacatcaccaccatcatgatgacagcatctggggatggggtgataaagatatgaaacaa
gatgacatggatatggtacaagtgcataatccaa

DBGET integrated database retrieval system