KEGG   Tribolium castaneum (red flour beetle): 656552Help
Entry
656552            CDS       T01046                                 

Gene name
Pka-C1
Definition
cAMP-dependent protein kinase 1
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:tca04310]
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:tca04340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG2
AA seq 353 aa AA seqDB search
MGNNAATANKKVDSAESVKEFLDQAKEDFEEKWKKNPTNTACLDDFERIKTLGTGSFGRV
MIVQHKPTKEYYAMKILDKQKVVKLKQVEHTLNEKRILQAISFPFLVSLRFHFKDNSNLY
MVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQ
GYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPP
FFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKGHKWF
ASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaatgccgcaacggcgaacaaaaaggtcgactccgccgaaagcgtgaaggag
ttcctcgaccaggccaaggaggacttcgaggagaagtggaagaagaatccgacaaacacc
gcctgtttggacgacttcgagcgcattaaaaccctaggtacgggttcattcggacgtgta
atgatcgtccaacacaaacccacgaaagagtactatgcgatgaaaatcctcgataagcaa
aaggtggtcaagttgaagcaggtggagcacaccctcaacgagaagcgcatcctgcaggcg
atcagtttcccgttcctagtcagtctgcggtttcacttcaaagacaattcgaacttgtac
atggtgttggagtatgtgcctggaggagagatgttttcgcatttgaggaaagtcggacgc
ttctctgagccacattcgaggttttatgctgcccaaattgtgctcgctttcgaatacttg
cactatctagatctgatctacagggatctgaaaccggagaatcttctcatcgactcgcag
ggatacctcaaggtcaccgatttcgggttcgctaaacgcgtcaaaggtcgcacctggacc
ttatgtggtacccccgaatatctcgcaccggagatcatcctcagcaagggttacaacaag
gcggtggactggtgggcactaggtgtcctagtctatgaaatggcggctggatatcctcca
tttttcgccgaccaacccattcaaatctacgagaaaatcgtttcggggaaagtgcgtttt
ccctcacatttcggttccgacctgaaggatctcctccgtaacctactccaggtggatttg
acaaaacgttacggtaatttgaaagccggcgttaacgacatcaaaggtcacaagtggttt
gcgtccactgattggatcgcgatttttcaaaagaagattgaagcacctttcatacccagg
tgcaagggacctggagatacgagtaatttcgacgattacgaggaggaggcgttgcgtatc
tcttcgacggagaagtgcgccaaggaatttgcggagttttga

DBGET integrated database retrieval system