KEGG   Tribolium castaneum (red flour beetle): 656552Help
Entry
656552            CDS       T01046                                 

Gene name
Pka-C1
Definition
cAMP-dependent protein kinase 1
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    656552 (Pka-C1)
   04340 Hedgehog signaling pathway
    656552 (Pka-C1)
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     656552 (Pka-C1)
Protein kinases [BR:tca01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   656552 (Pka-C1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG2
AA seq 353 aa AA seqDB search
MGNNAATANKKVDSAESVKEFLDQAKEDFEEKWKKNPTNTACLDDFERIKTLGTGSFGRV
MIVQHKPTKEYYAMKILDKQKVVKLKQVEHTLNEKRILQAISFPFLVSLRFHFKDNSNLY
MVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQ
GYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPP
FFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKGHKWF
ASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaatgccgcaacggcgaacaaaaaggtcgactccgccgaaagcgtgaaggag
ttcctcgaccaggccaaggaggacttcgaggagaagtggaagaagaatccgacaaacacc
gcctgtttggacgacttcgagcgcattaaaaccctaggtacgggttcattcggacgtgta
atgatcgtccaacacaaacccacgaaagagtactatgcgatgaaaatcctcgataagcaa
aaggtggtcaagttgaagcaggtggagcacaccctcaacgagaagcgcatcctgcaggcg
atcagtttcccgttcctagtcagtctgcggtttcacttcaaagacaattcgaacttgtac
atggtgttggagtatgtgcctggaggagagatgttttcgcatttgaggaaagtcggacgc
ttctctgagccacattcgaggttttatgctgcccaaattgtgctcgctttcgaatacttg
cactatctagatctgatctacagggatctgaaaccggagaatcttctcatcgactcgcag
ggatacctcaaggtcaccgatttcgggttcgctaaacgcgtcaaaggtcgcacctggacc
ttatgtggtacccccgaatatctcgcaccggagatcatcctcagcaagggttacaacaag
gcggtggactggtgggcactaggtgtcctagtctatgaaatggcggctggatatcctcca
tttttcgccgaccaacccattcaaatctacgagaaaatcgtttcggggaaagtgcgtttt
ccctcacatttcggttccgacctgaaggatctcctccgtaacctactccaggtggatttg
acaaaacgttacggtaatttgaaagccggcgttaacgacatcaaaggtcacaagtggttt
gcgtccactgattggatcgcgatttttcaaaagaagattgaagcacctttcatacccagg
tgcaagggacctggagatacgagtaatttcgacgattacgaggaggaggcgttgcgtatc
tcttcgacggagaagtgcgccaaggaatttgcggagttttga

DBGET integrated database retrieval system