KEGG   Tribolium castaneum (red flour beetle): 656563Help
Entry
656563            CDS       T01046                                 

Definition
(RefSeq) histone H2B
  KO
K11252  
histone H2B
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Chromosome [BR:tca03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    656563
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   656563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEETLEBASE: 
UniProt: 
Position
Un
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNISKSDKKKKRRRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaagacaagcggtaaagcagcgaaaaaggctggaaaagctcaaaagaatatt
tcgaagagcgacaagaaaaagaagcgcaggaggaaggaaagctatgcaatctatatttat
aaggtattgaagcaagtacaccccgataccggtatttcgagcaaggcgatgagcatcatg
aacagtttcgttaatgatatctttgaacggatcgccgctgaagcttctcgtcttgcgcat
tacaacaagcgttcgacgattacgagccgggaaattcaaacagcggttcgtctcttgttg
cctggtgaattggcaaagcacgcagtctctgaaggtaccaaagccgtcaccaaatacaca
agttcaaaatag

DBGET integrated database retrieval system