KEGG   Tribolium castaneum (red flour beetle): 656727Help
Entry
656727            CDS       T01046                                 

Gene name
Aurka, Stk6, aurA
Definition
aurora kinase A (EC:2.7.11.1)
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     656727 (Aurka)
Protein kinases [BR:tca01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   656727 (Aurka)
Protein phosphatases and associated proteins [BR:tca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     656727 (Aurka)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEETLEBASE: 
UniProt: 
Position
Un
AA seq 322 aa AA seqDB search
MSQRKAPVCQNKENNVPRAAAKKGPPAQKGALSENKAQKGAASDTAQESSKGRRWTLADF
DIGKPLGRGKFGNVYLAREKQSKFVVALKVLFKSAIKDFNNEHQVRREIEIQSHLRHNNI
LRMYGYFHDESRVYIILEYAPNGTCYKALQAAPNRRFPEETCARYIRQIADALSYCHTKK
VIHRDIKPENLLLCAQGQIKIADFGWSVHAPSSRRTTLCGTLDYLPPEMVVGQTHNEKVD
LWSLGVLCFEFLTGKPPFEAPTFEETYRNISKAYYKFPPYVSEGAQDLIRKLLVVNPNER
LELSQVMKHPWIVSHTEEKSSQ
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaaggaaggcccccgtgtgccaaaacaaggagaacaacgttccgcgcgccgcg
gcgaaaaagggccccccggcgcaaaagggggctctctccgagaacaaggcccagaagggg
gctgcaagtgacacggctcaggagagttcgaaggggcggcgttggaccttggcggacttc
gatatcgggaagcccctcgggcgtggtaaattcggaaacgtgtacttagctcgcgaaaaa
cagtcgaaatttgtcgttgcgcttaaagtgctgttcaaaagtgcgatcaaagacttcaat
aacgagcaccaagtgcggagggaaatcgagattcagtcgcacttgagacacaacaatatt
ctgcgaatgtatggctattttcacgacgagtcgagggtctacataatactggaatacgcc
cccaatggcacatgctacaaggcgctgcaagcagcccccaacaggcgcttcccggaggag
acatgcgcccgctacatccgccaaattgcggacgctctcagttactgccacacgaagaaa
gtcattcacagagacataaaaccggagaacttgctactttgtgcccaaggccaaatcaaa
atcgctgattttgggtggtctgtacacgccccctcctcccgtaggactactctctgtggc
acccttgattacctcccgcctgaaatggtcgtggggcaaacacacaacgaaaaagtggat
ttgtggagtttgggcgttttgtgttttgaatttctgacagggaagcccccatttgaagcg
cccacgttcgaggagacgtaccggaatatcagcaaggcctactacaagtttccgccgtat
gtctccgagggggcgcaagatttgattaggaaattgcttgtagttaatccaaatgaaagg
cttgagctgagtcaagtgatgaaacatccgtggattgtctcgcacacagaggagaagagt
agtcaataa

DBGET integrated database retrieval system