KEGG   Tribolium castaneum (red flour beetle): 656727Help
Entry
656727            CDS       T01046                                 

Gene name
Aurka, Stk6, aurA
Definition
(RefSeq) aurora kinase A (EC:2.7.11.1)
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     656727 (Aurka)
Protein kinases [BR:tca01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   656727 (Aurka)
Protein phosphatases and associated proteins [BR:tca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     656727 (Aurka)
Chromosome [BR:tca03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    656727 (Aurka)
   Spindle formation proteins
    656727 (Aurka)
  Sister chromatid separation proteins
   Aurora kinases
    656727 (Aurka)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEETLEBASE: 
UniProt: 
Position
Un
AA seq 322 aa AA seqDB search
MSQRKAPVCQNKENNVPRAAAKKGPPAQKGALSENKAQKGAASDTAQESSKGRRWTLADF
DIGKPLGRGKFGNVYLAREKQSKFVVALKVLFKSAIKDFNNEHQVRREIEIQSHLRHNNI
LRMYGYFHDESRVYIILEYAPNGTCYKALQAAPNRRFPEETCARYIRQIADALSYCHTKK
VIHRDIKPENLLLCAQGQIKIADFGWSVHAPSSRRTTLCGTLDYLPPEMVVGQTHNEKVD
LWSLGVLCFEFLTGKPPFEAPTFEETYRNISKAYYKFPPYVSEGAQDLIRKLLVVNPNER
LELSQVMKHPWIVSHTEEKSSQ
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaaggaaggcccccgtgtgccaaaacaaggagaacaacgttccgcgcgccgcg
gcgaaaaagggccccccggcgcaaaagggggctctctccgagaacaaggcccagaagggg
gctgcaagtgacacggctcaggagagttcgaaggggcggcgttggaccttggcggacttc
gatatcgggaagcccctcgggcgtggtaaattcggaaacgtgtacttagctcgcgaaaaa
cagtcgaaatttgtcgttgcgcttaaagtgctgttcaaaagtgcgatcaaagacttcaat
aacgagcaccaagtgcggagggaaatcgagattcagtcgcacttgagacacaacaatatt
ctgcgaatgtatggctattttcacgacgagtcgagggtctacataatactggaatacgcc
cccaatggcacatgctacaaggcgctgcaagcagcccccaacaggcgcttcccggaggag
acatgcgcccgctacatccgccaaattgcggacgctctcagttactgccacacgaagaaa
gtcattcacagagacataaaaccggagaacttgctactttgtgcccaaggccaaatcaaa
atcgctgattttgggtggtctgtacacgccccctcctcccgtaggactactctctgtggc
acccttgattacctcccgcctgaaatggtcgtggggcaaacacacaacgaaaaagtggat
ttgtggagtttgggcgttttgtgttttgaatttctgacagggaagcccccatttgaagcg
cccacgttcgaggagacgtaccggaatatcagcaaggcctactacaagtttccgccgtat
gtctccgagggggcgcaagatttgattaggaaattgcttgtagttaatccaaatgaaagg
cttgagctgagtcaagtgatgaaacatccgtggattgtctcgcacacagaggagaagagt
agtcaataa

DBGET integrated database retrieval system