KEGG   Tribolium castaneum (red flour beetle): 656904Help
Entry
656904            CDS       T01046                                 

Definition
tropomyosin 1-like
Orthology
K10373  
tropomyosin 1
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   656904
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEETLEBASE: 
UniProt: 
Position
LG10
AA seq 284 aa AA seqDB search
MDAIKKKMQAMKLEKDNAQDKADAMEGQAKDANLRVEKLNEELRELQKKLSQVEGDLTTT
KNSLEQANKDLEEKEKTLTNAEAEMASLNRKVQTIEEDLERSEERLATATTKLAEASQAA
DESSRMCKVLENRSQQDEERMDQLTNQLKEARLLAEDADNKSDEVSRKLAFVEDELEVAE
DRVKGGDAKIMELEEELKVVGNSLKSLEVSEEKANQRVEEFKKQLKTLTVKLKEAEARAE
YAEKTVKKLQKEVDRLEDELGINKDRYKSLADEMDSTFAELAGY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgatcaagaagaagatgcaagcgatgaagcttgagaaagacaatgctcaagac
aaggccgatgcgatggaaggccaagccaaggatgccaacctccgtgtcgagaaactcaac
gaggagttgcgcgaactccagaagaaactttcccaagttgaaggcgatctcaccaccacc
aagaactcgctcgagcaagccaacaaggatcttgaagagaaagaaaaaaccctcaccaac
gctgaagctgaaatggcctcactcaaccgcaaagtccagacgattgaggaggacttggag
cgttcggaggagcgcctggccacggctaccaccaagctcgccgaagcctcgcaagcggcc
gacgagagctcccgtatgtgcaaagtgttggagaaccgctcccagcaggacgaagagcgc
atggaccagctcaccaaccagctgaaggaggcccgtctgctggccgaagacgccgacaac
aaatccgacgaagtctcgcgcaagctagccttcgttgaagacgagctcgaggtggccgaa
gaccgcgtcaaaggcggcgatgccaagatcatggagctggaggaggagctcaaggtggtc
ggcaactcgctcaaatcgctcgaagtgtccgaggagaaggccaaccagagagtcgaggag
ttcaagaagcagctcaagaccctcaccgtcaagctgaaggaggccgaagcgcgagccgaa
tacgccgaaaagactgtcaagaaactccagaaggaagtcgacaggcttgaagatgagctt
ggcatcaacaaggacagatacaagtcacttgccgacgaaatggactcgactttcgccgaa
ctggctgggtattag

DBGET integrated database retrieval system