KEGG   Tribolium castaneum (red flour beetle): 657051Help
Entry
657051            CDS       T01046                                 

Definition
similar to CG3322-PA
Orthology
K05635  
laminin, gamma 1
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tca00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    657051
Cell adhesion molecules and their ligands [BR:tca04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      657051
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      657051
     Laminin-2 Extracellular matrix (ECM) components
      657051
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      657051
   VLA-3
      657051
     Laminin-10 Extracellular matrix (ECM) components
      657051
     Laminin-11 Extracellular matrix (ECM) components
      657051
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      657051
     Laminin-8 Extracellular matrix (ECM) components
      657051
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      657051
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      657051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG3
AA seq 1615 aa AA seqDB search
MRCQVPLTVFVLCVFGHAGGQEADITPVIGRKGTRCYDKFNKPQRCIPEFENAAFNVLME
ATNTCGEHGKTEYCVQSGVTGLRKSCEVCYPNDHQARYLTDFHNQDQPTWWQSETMYEGI
QFPNQVNLTLKLGKAFDITYVRLWYYSPRPESFSIFKKTAENGSWIPYQYYSATCRDTYG
LPDTQHTTRGEETRALCTSEYSDISPLRGGNVAFSTLEGRPSAYNFEASPELQEWVTATD
IMIVLDRLNTFGDEVFGDQQVLRSYFYAVADVAVGARCKCNGHASECITSTGVDGSRRRV
CKCEHNTAGPDCNECLPFYNDAPWKRATARDAHECKQCNCNGFSNRCYYDEELYRLTGHG
GHCLDCTANRDGPNCERCRENYYMREDGYCIACECNEKGSRSLQCNAEGKCQCKPGVTGD
KCDRCAVNYYEFSATGCKSCGCSEAGSVNNEPNCDPYTGVCYCKENVEGRRCRECKPGFF
NLDKDNEFGCTPCFCYGHSSECYSARNYAKHLIDSVFSRSTERWQAEDEYGRDVEIEHVP
LAHSIKAEARGDETVYFLANERFLGERRFSYNQLLQFSLWIGDYDRPIPTATDIILEGGG
ASVTNTIFAQQNKIPTNTKQKYSFRLHEHPNYGWQPRLSARAFMSLLDNITAIKIRATYA
PQGVGFLTDVKLETAAQKVAGPPALWVEQCVCPNGYVGYFCESCKPGYRHFPSLGGRFMP
CILCDCNQHAQICDSETGRCICEHNTAGENCEFCARGYYGNALGGTPDDCKPCGCPDGGA
CIQVDEDIIMCTECPVGHTGHKCDSCSDGYFGDPTGRFGPRQPCTQCDCNLNIDPNGIGN
CNTTTGECLKCIHNTGGPKCEVCLPGYYGNALALPKGDCQPCECNPAGTESNGGSIECDR
ITGSCHCRPHVIGRNCDQCEDGYFNLRSGEGCHSCNCDPIGSYNQTCNVYTGQCFCRPGI
TGLRCDHCEPFKYGFSSEGCKECECDKIGSRDHQCDPSGQCPCLDNVEGRRCDRCKENKY
DRQRGCIDCPECYNLVQDASKEHQEKLSKLSDILDEIERRPTVIDDDEFPTELEKLQTNI
DAFHEKVKNATGENSIIQQVRDIRNREKEISRTLSAIDENVYLANEKATAAEHNIENTDN
LLAETEDKLNDAFEDLDVRGRKALDSAWKRAQIVGQQSDRMTQIAHEAREIADQLDADAD
ALTQKANEAKNKSNEAYEIAKNAIRKQNNVSETERQIRSELVNTEIKLNKTKEWTQEVSD
RARETKKDALALLNEVTNLVIPEIDIPKLKEKAKRVKQEALQLRNDTNKILSESNKLLVE
IDEQLFRGREQLDRANIQQDDTADLLQEIYLYKSHAEAAVKMGNNILNSTKETYKILTHF
DKQVQDSRAASEEALKEVDEIQEMIDDAFDKATDAELTLREAKGNADAALKRALQANELA
KNASANAENIKNDADLLFQNASGLNEEADLMADRVEATQSALRTLIQETRSNDTLINQAK
EKVGRAGKETEEVSKKVSDLTKNVQSILAELGNLPQIDDNELDVLEKELRKAEEKVNEAK
LDEKLNDLREKQKGQNDLINFYKTQIDQLQREVENVEQIAKALPDGCFKRLELEP
NT seq 4848 nt NT seq  +upstreamnt  +downstreamnt
atgcggtgccaagtgcctttgactgtgtttgttctgtgcgtttttggacacgctggcggc
caggaggccgatatcacgccggtcataggccggaaggggacgaggtgctatgacaagttc
aataagcctcagaggtgtatacctgagttcgagaatgcagctttcaacgttttaatggag
gcgacgaatacgtgtggagagcatggcaagacggaatattgcgttcagtcgggagtaaca
ggactcaggaaatcttgcgaagtgtgttaccccaacgaccaccaagccagatacctcact
gattttcacaaccaggaccagcccacgtggtggcagtccgagacgatgtatgaagggatc
cagttccctaatcaagtgaatctgacgcttaaactgggaaaagcgttcgatattacctat
gtaagactgtggtactactcgccgaggcctgagagtttttcgattttcaaaaaaacggcg
gagaatgggagctggattccctaccaatattacagtgcgacatgccgggacacctacggt
cttccagacacccagcacacaacacgtggggaagaaactagagccctttgcacgtccgaa
tattcggatatctcgcccctgcgtggtggaaacgttgcgttttccacgctagaaggcagg
ccatctgcttacaatttcgaagctagtcctgaacttcaggaatgggtgacagctacggat
attatgatcgtcctcgaccgtctcaacaccttcggcgacgaagtctttggtgaccagcag
gtcctccgctcctatttctacgccgttgccgacgtcgctgtaggagctcgatgcaaatgc
aacggccacgcttccgaatgcatcacttccaccggagtcgacggctccagaagaagggtg
tgtaaatgtgaacacaatacagccggcccggactgtaatgaatgcttaccgttctataat
gatgctccctggaaaagagctaccgctcgagatgcgcatgaatgtaaacaatgcaattgc
aacgggttttctaatagatgctactacgacgaagaattgtaccgattgaccggacacgga
ggccactgcttggactgcacagctaaccgagacggtcccaactgcgaacgctgccgggaa
aattattacatgcgtgaagacggctactgtatcgcctgcgagtgcaacgagaaaggctcc
cggagcctccagtgcaacgccgagggcaagtgccagtgcaagcccggagtcaccggagat
aagtgcgacaggtgcgctgtcaactattacgagtttagcgccaccgggtgcaaaagctgc
ggatgttcggaagccggctctgtaaacaacgagcccaactgtgatccctacactggagtt
tgctactgcaaggaaaacgtcgaagggagaagatgcagggagtgcaagcccggctttttc
aatttagacaaagataacgaattcgggtgcactccgtgcttttgttacggacactcttcc
gagtgctactctgcgagaaattacgccaagcatttaatagactcggtattttcaagaagt
accgaacggtggcaagctgaagatgagtatggtcgagatgtggaaattgaacacgttcct
ttagcgcacagtattaaagctgaagcacgaggtgacgagactgtttacttcttggcaaat
gaaaggtttctgggcgaaaggaggttctcctataaccaactcctgcagttcagtctttgg
ataggtgactacgatcggcctatacccaccgctactgatattatcctggaaggaggggga
gcgtcggtcaccaacaccattttcgcgcaacaaaacaaaattccaacaaacacgaaacaa
aagtacagtttccgtctccatgagcaccccaactacggctggcaaccccgcctctcagcc
cgcgctttcatgtcccttttagacaacatcacggccatcaaaattcgcgcaacctacgcc
cctcaaggtgtcggtttcctcaccgacgtgaagctcgagacagcggcccaaaaagtggcc
ggtcctcctgctctttgggtcgaacagtgcgtctgccccaacggctacgtgggctacttc
tgcgagtcgtgcaagcccggctaccgccactttccttcacttggaggcagattcatgcct
tgcattctttgcgactgcaaccaacacgcgcaaatttgcgactccgagaccggacgatgc
atttgtgagcataacacagccggcgaaaattgcgagttttgtgccaggggatactatgga
aatgccctcggaggcactcccgatgactgcaaaccgtgtgggtgccccgatggcggtgct
tgtatccaagtggatgaggatataattatgtgtacggagtgcccggtgggtcatacggga
cataagtgcgactcttgttcagatgggtactttggggaccccacggggaggtttgggccg
agacagccttgcactcagtgtgactgtaacttgaatattgatccaaacggcatcgggaat
tgtaacacgaccacgggagagtgtttgaagtgtatccataatacaggggggcctaagtgt
gaagtgtgtttgccggggtattacggtaatgccttggcgttgccaaaaggggactgtcag
ccgtgtgagtgtaacccagcaggaactgaatcgaatggagggtcaatcgagtgtgatcgg
atcactgggtcgtgtcattgcagacctcatgttattggcaggaattgtgatcagtgtgag
gatggatatttcaatttgaggagtggagaagggtgccattcttgtaactgtgatcctatt
ggttcctataaccagacatgcaatgtatacactgggcagtgtttttgtcgaccgggaatt
acaggtcttcgctgtgaccactgtgagcctttcaaatacggattctcttccgagggctgc
aaggaatgcgagtgtgacaaaatcggttcgagagaccatcagtgcgatccttctggacaa
tgcccgtgtttggataacgttgaaggacgcagatgtgaccgatgcaaggaaaacaaatac
gaccggcaaagaggctgtatcgactgtcctgaatgttacaacttagtccaagacgcgtca
aaagaacaccaagaaaaactctcaaaactcagcgacattcttgatgaaatcgaaagacgg
ccaactgttatagacgatgacgaatttccaacagaactggaaaaactccaaaccaacatt
gatgctttccacgaaaaagtgaagaatgcgactggagagaacagtatcatccaacaagtc
cgcgacataagaaaccgagagaaagaaatatcacggacactttccgccatcgacgaaaat
gtctatctcgccaacgaaaaagccaccgccgctgagcacaacatcgaaaacactgacaat
cttttagccgaaactgaagacaagttgaacgatgcattcgaagatctggacgttcgtgga
agaaaagctctagacagtgcatggaagcgggcccagattgtaggtcaacaatccgatcgg
atgacccaaattgcccacgaagctcgggaaattgccgaccaacttgatgccgacgcggac
gctctaacccaaaaagccaacgaggctaagaacaaatcgaacgaagcttacgaaattgcc
aaaaacgccatcagaaaacaaaataatgttagcgaaacggaaagacaaatacgatcagaa
ctagtaaataccgaaatcaaactcaacaaaaccaaggaatggactcaggaagtcagcgac
agagcgcgagaaacgaagaaagacgctttagctttgctaaacgaagtcactaatttagtc
attcccgaaattgacattccgaaacttaaggaaaaagcgaagagagtcaaacaagaggct
ttgcagttgcgaaacgacaccaataagattctttccgagagtaataaactgttggtggag
attgacgaacagttgttcagagggcgcgaacaacttgatcgtgctaatattcaacaagac
gatactgccgatttgttgcaggaaatatatttgtataaaagtcacgccgaagctgccgtt
aagatgggcaacaacattttgaactcgaccaaagaaacgtacaaaattttgacacatttc
gataaacaggtgcaggacagtagagccgcctccgaagaggcgttaaaggaagtcgatgaa
atccaagagatgattgatgatgcgttcgacaaggctacagatgcggaactgacgcttcgg
gaagccaaaggcaatgctgatgcagcgctgaagagggcactccaagcgaacgaacttgcc
aaaaacgcctcagctaacgccgaaaatatcaaaaacgacgccgatttgctgttccagaac
gcctcaggcttgaacgaagaagcggatttgatggctgatcgagtggaggcgacccagtcg
gctttacggacccttattcaggaaacgaggtcgaatgatacgctgatcaaccaagccaaa
gaaaaagtcggacgggctggtaaagagactgaagaagtgtcgaagaaagtcagcgacttg
acgaagaatgtgcaaagtattttagccgaattggggaatttgccacaaattgatgacaac
gagttggacgtattggagaaggagctgcggaaggctgaagaaaaagtcaatgaagctaaa
cttgacgagaaactgaatgacttgcgggagaaacaaaagggacagaacgacttgattaat
ttttacaagacgcaaattgatcaactgcagagggaagttgagaacgttgaacaaatagcg
aaggcgcttcctgatggctgtttcaagcgactcgaacttgaaccttaa

DBGET integrated database retrieval system