KEGG   Tribolium castaneum (red flour beetle): 657075Help
Entry
657075            CDS       T01046                                 

Definition
GA17312-PA-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tca00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG1=X
AA seq 692 aa AA seqDB search
MGGKYSSLDPMEIEVPEIDKLLARDPYLKPFEKEIRRRYGCFKDLLETIDENGCGLDSFT
QGYKYYGLHVQPDNTIVAREWAPGAVQLFLTGDFNGWNRDSHRYKKLEFGKWELVIPPKP
DGSCAIPHLSEVKVVVETQSGTKEDRLSPYATYVVEPPKDQGTIYKQKFWNPPNSEKYEF
RHSRPAKPKGLRIYECHVGIATSELKVGSYDNFTDNILPRIVKQGYNTIQLMAIMEHAYY
ASFGYQVTSFYAASSRYGTPEQLKRLIDRAHELGLTVLLDLVHSHASKNVLDGLNQFDGT
DSCFFHAGARGEHSLWDSRLFNYQEFEVMRFLLSNIRWYMEEYKFDGFRFDGVTSMLYHS
RGIGQGFSGNYEEYFGLNVDTEGLVYLMLANHVAHHFNPDGITIAEDVSGMPGTCRPISE
GCLGFDYRLAMAVPDKWIKLLKHYSDDDWNVGNIVHTLTNRRWMEPSVAYAESHDQALVG
DKTIAFWLMDKEMYTHMSTLSPSSPVVERGLALHKLIRFITHALGGEAYLNFMGNEFGHP
EWLDFPRAGNNNSYHYARRQWQLVDDELLKYKFLNNWDAAMNHAEEKYGWLSAPPAYVSW
KHEDDKVIAFERAGLLFVFNFHPTKSFADYKLGFEGEGEFRIALCSDDKEFGGHSRIDTS
IHNFTKPESFCGRRNSIQVYIPSRTVIMLAKV
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgggtggaaaatactcgtctttggaccccatggagatcgaggtgcctgaaattgataaa
ctcctcgctagagacccgtatcttaagccgtttgagaaggaaatccgtcgccgatatggg
tgttttaaagacctgcttgaaacaattgatgagaatgggtgcggtttggacagtttcacc
caagggtataagtactatgggcttcacgtccagccagacaacacaattgtggccagagag
tgggccccgggcgctgtgcagttgttcctaacaggagactttaatggctggaacagggac
agccaccgttacaagaaactggagtttggcaaatgggaattagtcataccgccaaaaccc
gatggttcatgtgccataccccacttatccgaagtcaaagtggttgtggaaacacaatct
ggaacaaaagaagatcgcttatcgccctatgccacatatgtggtcgagccgccaaaagac
caaggaacaatttacaaacaaaagttctggaacccgccaaactcagagaagtacgaattt
cggcactcaagaccggcgaaaccgaaaggcttgcgcatatatgaatgccatgtcggcata
gccacgtctgaactgaaagtgggttcctacgacaatttcactgataatattctaccacgg
atcgtaaaacaaggctataacacgattcagctcatggcaataatggagcacgcatattat
gccagtttcggttatcaagtaactagtttttacgccgcgtctagtcgttacgggacaccc
gaacaactgaaacggttgatagaccgggcacatgagctcggtttaaccgttctgctcgac
ttggtccattcacacgccagtaaaaacgtgttggatgggttgaaccagttcgacggtact
gactcgtgtttcttccatgcgggggcgcgcggggagcactctttgtgggactcaagactg
ttcaattaccaggaattcgaagtgatgcggtttttgttgtccaacattcgttggtacatg
gaggagtacaagttcgatgggtttaggttcgatggggtcacctccatgttgtaccattcg
cgggggatcgggcaaggtttcagcgggaattacgaggagtatttcgggttgaacgtcgat
actgaaggcttagtctacctgatgttggccaatcacgtggcgcaccatttcaatcctgat
ggtataaccatagccgaggacgtgtcaggcatgcctgggacttgccgcccaattagcgag
ggttgcctaggttttgactaccgcctagctatggctgtgcccgataagtggatcaaactg
ctcaagcactactctgacgacgactggaacgtgggcaatatcgtgcacacgctcactaac
cggaggtggatggaacccagcgtggcttacgccgagtcgcacgaccaggccctcgttggc
gacaagaccattgccttttggctgatggacaaggagatgtacacccacatgagcaccctc
tcgccctcgtcccccgtggttgagcgcgggctcgctctgcacaagctaatccggttcata
acgcacgcattggggggcgaagcctacctcaatttcatggggaacgagttcggacacccc
gaatggctcgacttcccgcgcgctgggaacaacaactcctatcattacgcgcgccggcag
tggcagctagtcgacgacgagctcctcaagtacaaatttttgaacaactgggacgccgcg
atgaaccacgccgaggagaagtacggctggttgagcgcacccccggcctacgtcagctgg
aagcacgaggacgataaggtgatagcgttcgaacgcgccggcttgttattcgtcttcaat
ttccacccaacgaaaagtttcgcggattataaacttggattcgagggcgagggcgagttt
cgcatcgccttgtgttcggacgataaggaattcgggggccacagtaggatcgatacgtcg
attcataatttcacgaaaccggaaagtttctgcgggaggagaaactcgattcaggtgtat
ataccttccaggactgttatcatgttggccaaagtctaa

DBGET integrated database retrieval system