KEGG   Tribolium castaneum (red flour beetle): 657149Help
Entry
657149            CDS       T01046                                 

Definition
cGMP-dependent protein kinase, isozyme 1
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     657149
Protein kinases [BR:tca01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   657149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEETLEBASE: 
UniProt: 
Position
Un
AA seq 948 aa AA seqDB search
MVESCPRSSMKQINNLMVEESYSLNLYPASVGALAMIGHAQQEPLEGARALFKKSHTCGS
LYAKCGCSHDPPPPPVQPRAPEPPPSPSKRGSTPAIASIYPRADTKRLSNPEINNSSRHK
TVIKANVYLNHPEITFPIPVELQDKPNLAKSLPTSIDLDEVKKSNLDYHKYNVLAYECSA
SKEEEAKKFLSDFGIFGPMGNGVATLRRSSKSSLDGDVIQQIRKNSRRLSGAHEENDYLK
TIVARLKKDLAELEVKYGSLQSELYETRRQLTCKESEVLKLQREIHKLKSVLQQTTTFIQ
DGDILTSLQEKHAMANRAPQSQQSLTNSCVLKKQGVSAESSESTGQASDITIPKHDKDFR
SKQLIKDAIMDNNFLQNLDTSQVREIVDCMYLKEYPQGSYVIKEGEAGAHLFVSAEGDFE
VMKEDKVLGHMGPGKAFGELAILYNCTRTASIRVVVDSKVWVLDRKVFQQIMVRTGLQRL
QDNINFLRSVPLLQNLSNEVLAKIADVLEVEFYPAGVYIIRQGANGDTFFIISSGSVKVT
QRKQGSMEDEEEIRILQRGDYFGEQALLKEDCRTANIIAMNPGVECLTLDRESFKQLIGD
LSEIKEKNYGDEQRLNRQINSTCAENSEYDYISLDDLEVIATLGIGGFGRVELVQYVHNP
SLTFALKCLKKQHIVDTQQQDHIFSERNIMMSCRSSFICRMYKTFKDSKYVYMLLEACLG
GEVWTILRDRGCFDEDTTKFITGCVLEAFDYLHSRGIIYRDLKPENLLLDANGYVKLVDF
GFSKRLGYSSKTWTFCGTPEYVAPETILNKGHDRAVDYWALGILMHELLTGNPPFTASDP
MKTYNLILKGIDMIDFAKHHIGRAAQSLIKKLCRDAPSERLGYQKGGIQDIKKHKWFQGF
DWDGLVNQTLPSPIRQPVRGCCDTTNFDCFGKDNDIPPDELSNWDLEF
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaatcctgtccgagatcctcgatgaagcagataaataacttgatggtggaagaa
tcgtacagtttgaatttgtatcccgcctcagtcggcgccctagcaatgatcggccatgcg
cagcaggagcccttggagggggcccgcgccctcttcaaaaaatcgcacacatgcggcagc
ctctacgccaagtgcggctgcagccatgaccccccgccgccccccgtccagccgcgcgcc
cccgagccgccccccagcccctcgaagaggggctccacgcccgccatcgcctccatctac
ccgcgagccgacaccaaacgcctctccaacccggagatcaacaacagctcgcgccacaag
accgtcatcaaagccaacgtctacctgaaccaccccgagatcacgttccccatcccggtg
gagctccaggacaagcccaacctcgccaagtcgctgcccaccagcatcgacctggacgaa
gtcaaaaagtccaacctagactaccacaagtacaacgtgctggcctacgaatgcagcgcc
agtaaggaggaagaagcgaagaagttcctcagcgatttcggaatcttcgggccgatgggc
aacggtgtcgcgacccttcggcgaagctccaaaagctcgctcgacggcgacgtcatccag
caaatccggaaaaactcgcgccgactttccggagcgcacgaagagaacgactacttgaaa
acaatcgtcgcgcgattaaaaaaagatcttgcggaactggaagtcaagtatggatcgcta
caatcggaactgtacgaaaccaggaggcagctcacgtgcaaagagagcgaagtgctcaaa
ttgcaacgcgaaattcataagctcaagagcgtactccagcaaaccacaacatttattcag
gatggcgatattctcacgagcctccaggaaaagcacgcgatggctaaccgagctccccaa
agtcaacaatctctcaccaacagctgtgttttaaagaaacagggtgtatcagccgaatcg
agcgaatccaccggtcaagcaagcgacattaccattccgaaacatgataaggacttcagg
tccaaacagcttatcaaagacgcgatcatggacaacaactttttgcaaaatttggacacg
tcacaagtgcgagaaatcgtcgactgcatgtacctcaaggagtatccgcagggttcttat
gtgatcaaggaaggagaagctggagcgcatttatttgtctcagctgagggtgattttgag
gtgatgaaagaagataaggttttggggcacatggggccagggaaagccttcggagagttg
gcgattttgtataattgtacccgaactgcttcaattcgagtggttgttgactcaaaagtc
tgggttttggaccgaaaggtcttccaacaaatcatggtccgaactggccttcagagactc
caagacaatatcaattttctccgctctgtgcctctcctccagaatctcagcaacgaagtt
ttggcaaaaatagcagacgtcctcgaagtcgaattttatcctgcaggtgtttacattata
agacaaggggccaacggtgacaccttctttatcataagcagcggctccgttaaagtaacg
caacggaaacagggctccatggaagatgaggaagaaatcaggattctccaacgtggcgat
tacttcggcgaacaagctttactaaaagaagactgcaggactgccaacataattgcaatg
aatccaggggttgaatgcttgacacttgaccgggaatctttcaagcaactaatcggagat
ctgagcgaaatcaaggaaaaaaactacggtgatgaacaaagacttaaccgccaaatcaac
tcaacgtgtgccgaaaactcggaatatgactacatcagtttggacgatcttgaagtgatt
gcaacgctcggtattggaggttttggtcgagttgaactagttcaatacgttcacaatccg
tcactaactttcgctctcaagtgcctcaagaagcaacatatcgtggacacgcaacagcag
gaccacatcttcagcgaacgcaacatcatgatgagctgtcggagcagtttcatctgcagg
atgtacaaaacgttcaaggattccaaatatgtgtacatgttgctggaggcgtgtctgggt
ggcgaagtttggacgattctacgagatcgaggatgtttcgatgaagacacgaccaaattt
atcaccgggtgcgttttggaagcgtttgattatctacacagtagagggataatctacagg
gacctcaaacccgaaaatctgctcttggacgccaatggatacgtgaaacttgttgatttt
gggttttcgaaacggctggggtacagtagcaagacttggactttttgcggaacgcctgaa
tatgtagcgccggaaactatcctcaacaagggacatgaccgagctgtggactactgggct
cttggaattttaatgcacgaacttttaaccggaaatcccccgtttacggcttcagacccc
atgaaaacctacaatctcatactgaaaggcatagatatgatcgattttgccaaacatcat
atcgggagagcggcacaaagtcttatcaaaaaattgtgtcgggatgctccatcggagagg
ttggggtatcagaaaggtggaatacaagatattaaaaaacataaatggtttcaaggattt
gactgggatggtttagtcaatcaaacgctaccttcaccaattagacaaccagtgagaggt
tgttgcgatacaaccaattttgactgctttggcaaagataacgacattcctccagatgag
ttatcaaactgggatttggaattttaa

DBGET integrated database retrieval system