KEGG   Tribolium castaneum (red flour beetle): 657237Help
Entry
657237            CDS       T01046                                 

Definition
ubiquitin specific protease-like
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    657237
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     657237
Peptidases [BR:tca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   657237
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG1=X; LG2
AA seq 596 aa AA seqDB search
MTILEDNVIPLRSKLRLPTQNQAPKREGSFLEAPYRKRQELDMLNGYRAPEAGDFPVATL
ANMGNTCFLNSVLYTLRYAPTFLHNLHHLIGDLALVSSRLSQTKAKTSSLGRNVGAITGP
SSRSTSSKDLLALSSSDIIPKSKVQIVTEKLHELYVTMHNLEVKESSDAYQPVALLQAIR
EANSIFEGNHQQDAHELLVYLLDNIRETCDLLTQQVQQNPDLLTESEIIPSPNSSKIWSV
RRSWKITKKKEKNAKEAISEEQVNGASVTDTEDACSVDGGGDNNKKKLGYNFVAEDFEGV
TLRRTRCLECESVTERKEPFYDIPVPIPVKDTDFEPDSASEIYRKACVTSEKLCDANKYL
CEKCQRYNEASRDVLFEKLPNIMVLQLKRFTTSSAGVQKVNTYLPTPLELECFCESCCNV
EEDETPPHRYRLCCVIMHLGASMASGHYIAYVKASDHFEDYVECSRNMPKGSLSASSSEK
SLNILKFFKPRTIGSLSENKSILSKSVVNGVRMCKSMDCCGVKINKNVVENVVNSYPRNK
EDFCNGGPEDMWLECDDESVKPITSQEFKEELAFKPNSTSTPYLLFYSKITDIPLD
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgacaattctggaagataacgtaatccccttgcgtagcaaactacgtctcccgacgcaa
aatcaggccccgaagcgcgaaggctcattcctcgaagccccctatcgcaagcgccaggag
ctggacatgttgaacggctatcgggcccccgaagcgggcgatttcccagtcgccaccctc
gcgaacatgggcaacacgtgcttcctcaacagcgttctgtacactctgcgctacgccccg
acgttcctacataacctccaccacctgatcggcgacctggcgctcgtaagctcgcgcctc
agccagaccaaagccaagacctcatcgctggggcgcaacgtgggggccatcacgggcccc
agctcgcgcagcaccagcagcaaggacttgctcgccttgagctcctccgacattatcccc
aagtctaaggtgcaaatcgtcaccgagaagctgcacgagctctacgtcacgatgcacaat
ttggaggtgaaggagtcgagcgatgcctaccaacctgttgcactcctccaagccattcgg
gaggcgaattcgattttcgaagggaaccaccagcaagacgcccatgagttgctcgtctac
ttgttggataatataagggagacatgtgacttgcttacgcaacaagtgcaacaaaacccc
gatttgttgactgagagtgagatcattccctcgcccaacagcagcaagatttggagtgtg
cgacgttcgtggaaaatcacgaagaagaaggaaaagaacgcgaaggaggctataagtgag
gagcaagtcaacggtgcgagtgtcactgacacggaggacgcctgttccgtcgacggaggc
ggcgataacaacaagaagaagctggggtacaacttcgtcgcagaggacttcgaaggtgtg
accctccggcgcaccaggtgtctcgaatgcgagagcgtgaccgagcgcaaggagccgttc
tacgacatcccggtgccaatccccgtcaaagacaccgatttcgagccggactctgcgagc
gaaatctaccgcaaagcgtgtgtcactagtgaaaagttgtgcgatgccaataaatatttg
tgtgagaagtgccagcgttataatgaggctagtcgtgacgtcctcttcgagaaactcccg
aatattatggtcctgcaactcaagcgcttcaccacgtcttccgccggcgtgcagaaagtc
aacacttacctcccgacgccgctcgaactggagtgcttttgcgagtcgtgttgcaacgtg
gaggaggacgagacgcccccgcatcgctaccgcctgtgctgcgttatcatgcacctgggg
gcgtccatggcctcgggccactacatcgcctacgtgaaggcgtccgatcacttcgaggac
tacgtcgagtgctccaggaatatgcccaaggggagtttgtcggcgagcagcagcgagaag
tcgctcaacattttgaagttttttaagcccaggacgatagggtcgttaagtgagaacaag
agtattttgtcgaaaagtgtggtgaacggtgtgaggatgtgcaaaagtatggactgttgt
ggcgttaaaattaataaaaatgtggtggagaacgttgttaactcttatccgaggaacaaa
gaggatttttgcaacggcgggcccgaggatatgtggttggagtgcgatgatgaaagtgtt
aaacccataacgagtcaagagtttaaggaggagttggcgttcaaacccaactccacctcg
acgccctacttgctgttctattccaaaattactgatatacctttagattaa

DBGET integrated database retrieval system