KEGG   Tribolium castaneum (red flour beetle): 657286Help
Entry
657286            CDS       T01046                                 

Definition
phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    657286
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    657286
   04068 FoxO signaling pathway
    657286
   04070 Phosphatidylinositol signaling system
    657286
   04150 mTOR signaling pathway
    657286
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     657286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG9
AA seq 1021 aa AA seqDB search
MRENNLQMPPFPREYSPDFWSFDPEDSVELTCLMPNGIVILLKVSYNATLLDIKADLWEE
APKYPLHGKLHDMSSYVFTCINSMAEREELHDETRRICDVKPTCAVLKIECLGNEPDNKI
NVQIGHLIGRSVKEFDELNNPEINDFRFQMRKLGDDITQKRLKYTWLEKLYYQFPPRLCP
KSKIFPETLDQKKNIKITTRFEDNENSFTFNVSPYIYPNKLLEMILAKRSNVLKIRYDRC
NDYVLKVCGQDEYLVGDHQLIQFQYIQDSLSTDVTPIVVTVRVNKVPVTPDNPYESLDNF
DHRRMRSTYSTLTWRKRAHKSAWDIQRKFSVTLNAVSGLNCDMRKTNEIGIQVGLFHGGK
SLCERLKASIQPINEKNESFFRETLVFDILVCNIPRNAKLCFCIYEVPKSSKLVRTKKGK
EYGNNKESITPIAWANTTVYDFKNQLRNGAMTLYMWTFANDLMCEDIFNALGNVVNNPNK
SATALTLHLISFAEDQTENDNLFEVHEQDRKNIWLLKDYWKKQNPEVLPKLLSSIDWDTR
EVVSDVAALLKDWPKLPPEKALELLDYAYPDQRVRSFAVECLDDVSDEDLLLYLLQLVQA
IKHEMYLECDLVKFLIKRALNNQKIGHYLFWHLKSELQVPSVSVRFGLILEAYCRGSQEH
MPVLLKQLEFLDKLKNSREHVKNKSKEKAKSNLKDYLTECHIDETVQNIRSPLDPSFRCS
KIKLDRCRIMDSKMRPLWIVLQNYDPFGDDVYIIFKDGDDLRQDMLTLQMLKIMDRLWKS
EGLDLRLSPYNCISLGDRAGMIEVVLNAETIANIQKDKGVFSATSAFRKGSILAWLRDHN
PTESALNKAINEFTLSCAGYCVATYVLGVADRHSDNIMVKKSGQLFHIDFGHILGHFKEK
FGIKRERVPFVLTHDFEYVINKGQKTTLEFKIFQEYCEKAFVILRKHGSLILSLCAMMIS
TGLPELSSEKDLNYIRDTLALSKSEEEALNHFRNKFDEALSNSWKTSLNWASHNLAKNNK
A
NT seq 3066 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaaaacaatctccaaatgcctccatttccccgagaatactccccggacttctgg
tcctttgacccagaagattccgtggaattgacttgtctcatgcctaacgggattgtgatt
ctcctcaaagtatcctacaatgccaccctactggacatcaaagcggacttgtgggaggag
gcccccaagtacccgctccatggcaagctccacgacatgtcctcgtatgtcttcacctgc
attaatagcatggcagagcgggaggagctgcatgacgagacgaggagaatctgcgatgtt
aaacctacttgcgctgtactgaaaattgagtgccttgggaatgaaccagataacaagatc
aatgtccagatcgggcatttgatagggaggagtgttaaagaatttgacgagttgaataat
cccgagattaacgatttccgttttcaaatgcggaaattgggcgatgatattacgcagaaa
cgcttgaaatatacgtggcttgaaaagttgtattatcagtttccgccgcgactgtgtccc
aaaagcaaaatctttccggaaacgcttgaccaaaaaaagaatattaaaattactacacga
tttgaagataatgagaattcttttacgttcaatgtctctccttacatttacccaaacaaa
ttattggaaatgattctcgcgaaaaggtccaacgttttgaaaatcagatacgaccgttgt
aacgattatgtattaaaagtgtgtggccaggacgagtatttagtaggagatcaccaactc
attcaattccaatacatccaagactctttatctacagacgtaactcctattgtggtcaca
gtgagagttaacaaagtcccagtcactcctgataatccctacgaatcgttggataatttc
gaccacaggagaatgcggtcgacttattcaacattaacatggcgtaaaagagcccacaag
tcggcttgggatattcagaggaagtttagtgtgactttgaacgcagtcagcggattgaat
tgtgatatgaggaaaacaaatgagattggcattcaggtgggattgtttcatgggggaaag
tcgctttgcgaaagacttaaagcttccatccaaccaataaacgaaaagaatgaaagtttt
tttcgtgagactttagtttttgatatcttagtgtgcaatatacccagaaatgcgaaattg
tgtttttgcatttatgaagttcctaaatctagtaagttagttagaacgaaaaaaggcaaa
gaatatggaaataataaggagtctattactcctatagcttgggctaatacgaccgtttac
gattttaaaaaccagctgagaaatggcgcaatgacactttacatgtggacttttgccaac
gatttgatgtgtgaggatatatttaatgctttagggaatgttgttaataatccgaataaa
agtgcaacggccttaacactacatcttattagtttcgccgaggatcaaaccgaaaatgac
aatttgtttgaggttcatgaacaggatcgaaaaaatatctggctgttgaaagactattgg
aaaaaacaaaatccggaagtccttcctaagctgttatcttcgattgactgggatactcgt
gaagtggtgagcgatgtagctgcactattaaaagactggcctaagcttccgcctgagaaa
gcattagaattattagattatgcatatcctgatcagagagttcggagttttgcagttgaa
tgtctggacgatgtcagtgacgaggacttacttctttatctcttacaattagtacaagca
atcaaacacgaaatgtatctagaatgtgatttagtaaaatttctaataaaacgagcgcta
aataatcaaaagatcggtcactacttattctggcatctcaaatccgagctgcaagtccca
tctgtatcggtccggttcggacttattctggaagcctattgcagagggagtcaggaacac
atgcctgtgttgttaaaacagttagaatttctcgataagttgaagaacagtcgagaacac
gtcaagaacaaaagcaaggaaaaggctaaatcaaatctcaaagattacttaacagagtgc
cacattgacgagaccgtgcaaaacattaggagcccgctggaccccagtttccggtgctct
aaaataaaattagacagatgtaggattatggatagcaaaatgcggccgttgtggatcgtt
ctccagaattacgatccgttcggagacgatgtttacattattttcaaagacggcgacgac
ttgagacaagatatgctcacgttgcagatgttgaagattatggatagattgtggaagagc
gaagggttggatttaagattgagtccgtacaattgcatatcgttaggagatagggccggt
atgattgaagtagtgctcaacgcggagaccattgccaacatccagaaggacaagggcgtg
ttttcggccacttcggccttccgcaagggctcgattttggcttggttgagagaccacaac
ccgacggagtcagctctcaacaaggccatcaacgagttcaccctttcgtgtgccggctat
tgcgtcgcgacgtacgtcttgggcgtcgcggatcgccattctgacaatataatggtcaaa
aaatcaggtcaactgtttcacatcgactttggccacattttgggccattttaaggagaaa
tttgggataaaacgggaaagagtcccgtttgtgttgacccacgactttgaatatgtcata
aacaaggggcagaagacgacgcttgagtttaaaatttttcaggagtattgtgagaaggct
tttgtcattttgcgaaaacatgggagtttgattttgtcgctgtgtgcgatgatgatttcg
accggtttgcccgagttgagttcggagaaggacttgaattacatcagagacactttggcc
ctgtcgaagtcggaggaggaggcgctaaaccactttaggaataaattcgacgaagctttg
tcgaactcgtggaagacttcgttgaattgggcgtcgcataacttagcgaagaataataaa
gcatga

DBGET integrated database retrieval system