KEGG   Tribolium castaneum (red flour beetle): 657286Help
Entry
657286            CDS       T01046                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Longevity regulating pathway - multiple species
AGE-RAGE signaling pathway in diabetic complications
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    657286
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    657286
   04070 Phosphatidylinositol signaling system
    657286
   04150 mTOR signaling pathway
    657286
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    657286
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    657286
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     657286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
LG9
AA seq 1061 aa AA seqDB search
MRENNLQMPPFPREYSPDFWSFDPEDSVELTCLMPNGIVILLKVSYNATLLDIKADLWEE
APKYPLHGKLHDMSSYVFTCINSMAEREELHDETRRICDVKPTCAVLKIECLGNEPDNKI
NVQIGHLIGRSVKEFDELNNPEINDFRFQMRKLGDDITQKRLKYTWLEKLYYQFPPRLCP
KSKIFPETLDQKKNIKITTRFEDNENSFTFNVSPYIYPNKLLEMILAKRSNVLKIRYDRC
NDYVLKVCGQDEYLVGDHQLIQFQYIQDSLSTDVTPIVVTVRVNKVPVTPDNPYESLDNF
DHRRMRSTYSTLTWRKRAHKSAWDIQRKFSVTLNAVSGLNCDMRKTNEIGIQVGLFHGGK
SLCERLKASIQPINEKNESFFRETLVFDILVCNIPRNAKLCFCIYEVPKSSKLVRTKKGK
EYGNNKESITPIAWANTTVYDFKNQLRNGAMTLYMWTFANDLMCEDIFNALGNVVNNPNK
SATALTLHLISFAEDQTIYYPTTEAMINFAQENKSKYISNSIEYNPTNIEHCQKILTEND
NLFEVHEQDRKNIWLLKDYWKKQNPEVLPKLLSSIDWDTREVVSDVAALLKDWPKLPPEK
ALELLDYAYPDQRVRSFAVECLDDVSDEDLLLYLLQLVQAIKHEMYLECDLVKFLIKRAL
NNQKIGHYLFWHLKSELQVPSVSVRFGLILEAYCRGSQEHMPVLLKQLEFLDKLKNSREH
VKNKSKEKAKSNLKDYLTECHIDETVQNIRSPLDPSFRCSKIKLDRCRIMDSKMRPLWIV
LQNYDPFGDDVYIIFKDGDDLRQDMLTLQMLKIMDRLWKSEGLDLRLSPYNCISLGDRAG
MIEVVLNAETIANIQKDKGVFSATSAFRKGSILAWLRDHNPTESALNKAINEFTLSCAGY
CVATYVLGVADRHSDNIMVKKSGQLFHIDFGHILGHFKEKFGIKRERVPFVLTHDFEYVI
NKGQKTTLEFKIFQEYCEKAFVILRKHGSLILSLCAMMISTGLPELSSEKDLNYIRDTLA
LSKSEEEALNHFRNKFDEALSNSWKTSLNWASHNLAKNNKA
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaaaacaatctccaaatgcctccatttccccgagaatactccccggacttctgg
tcctttgacccagaagattccgtggaattgacttgtctcatgcctaacgggattgtgatt
ctcctcaaagtatcctacaatgccaccctactggacatcaaagcggacttgtgggaggag
gcccccaagtacccgctccatggcaagctccacgacatgtcctcgtatgtcttcacctgc
attaatagcatggcagagcgggaggagctgcatgacgagacgaggagaatctgcgatgtt
aaacctacttgcgctgtactgaaaattgagtgccttgggaatgaaccagataacaagatc
aatgtccagatcgggcatttgatagggaggagtgttaaagaatttgacgagttgaataat
cccgagattaacgatttccgttttcaaatgcggaaattgggcgatgatattacgcagaaa
cgcttgaaatatacgtggcttgaaaagttgtattatcagtttccgccgcgactgtgtccc
aaaagcaaaatctttccggaaacgcttgaccaaaaaaagaatattaaaattactacacga
tttgaagataatgagaattcttttacgttcaatgtctctccttacatttacccaaacaaa
ttattggaaatgattctcgcgaaaaggtccaacgttttgaaaatcagatacgaccgttgt
aacgattatgtattaaaagtgtgtggccaggacgagtatttagtaggagatcaccaactc
attcaattccaatacatccaagactctttatctacagacgtaactcctattgtggtcaca
gtgagagttaacaaagtcccagtcactcctgataatccctacgaatcgttggataatttc
gaccacaggagaatgcggtcgacttattcaacattaacatggcgtaaaagagcccacaag
tcggcttgggatattcagaggaagtttagtgtgactttgaacgcagtcagcggattgaat
tgtgatatgaggaaaacaaatgagattggcattcaggtgggattgtttcatgggggaaag
tcgctttgcgaaagacttaaagcttccatccaaccaataaacgaaaagaatgaaagtttt
tttcgtgagactttagtttttgatatcttagtgtgcaatatacccagaaatgcgaaattg
tgtttttgcatttatgaagttcctaaatctagtaagttagttagaacgaaaaaaggcaaa
gaatatggaaataataaggagtctattactcctatagcttgggctaatacgaccgtttac
gattttaaaaaccagctgagaaatggcgcaatgacactttacatgtggacttttgccaac
gatttgatgtgtgaggatatatttaatgctttagggaatgttgttaataatccgaataaa
agtgcaacggccttaacactacatcttattagtttcgccgaggatcaaacgatttattat
ccaacgacggaagcaatgattaattttgctcaggaaaacaaaagcaaatatattagtaac
agtattgaatacaatccgacgaacatcgaacattgtcagaaaattcttaccgaaaatgac
aatttgtttgaggttcatgaacaggatcgaaaaaatatctggctgttgaaagactattgg
aaaaaacaaaatccggaagtccttcctaagctgttatcttcgattgactgggatactcgt
gaagtggtgagcgatgtagctgcactattaaaagactggcctaagcttccgcctgagaaa
gcattagaattattagattatgcatatcctgatcagagagttcggagttttgcagttgaa
tgtctggacgatgtcagtgacgaggacttacttctttatctcttacaattagtacaagca
atcaaacacgaaatgtatctagaatgtgatttagtaaaatttctaataaaacgagcgcta
aataatcaaaagatcggtcactacttattctggcatctcaaatccgagctgcaagtccca
tctgtatcggtccggttcggacttattctggaagcctattgcagagggagtcaggaacac
atgcctgtgttgttaaaacagttagaatttctcgataagttgaagaacagtcgagaacac
gtcaagaacaaaagcaaggaaaaggctaaatcaaatctcaaagattacttaacagagtgc
cacattgacgagaccgtgcaaaacattaggagcccgctggaccccagtttccggtgctct
aaaataaaattagacagatgtaggattatggatagcaaaatgcggccgttgtggatcgtt
ctccagaattacgatccgttcggagacgatgtttacattattttcaaagacggcgacgac
ttgagacaagatatgctcacgttgcagatgttgaagattatggatagattgtggaagagc
gaagggttggatttaagattgagtccgtacaattgcatatcgttaggagatagggccggt
atgattgaagtagtgctcaacgcggagaccattgccaacatccagaaggacaagggcgtg
ttttcggccacttcggccttccgcaagggctcgattttggcttggttgagagaccacaac
ccgacggagtcagctctcaacaaggccatcaacgagttcaccctttcgtgtgccggctat
tgcgtcgcgacgtacgtcttgggcgtcgcggatcgccattctgacaatataatggtcaaa
aaatcaggtcaactgtttcacatcgactttggccacattttgggccattttaaggagaaa
tttgggataaaacgggaaagagtcccgtttgtgttgacccacgactttgaatatgtcata
aacaaggggcagaagacgacgcttgagtttaaaatttttcaggagtattgtgagaaggct
tttgtcattttgcgaaaacatgggagtttgattttgtcgctgtgtgcgatgatgatttcg
accggtttgcccgagttgagttcggagaaggacttgaattacatcagagacactttggcc
ctgtcgaagtcggaggaggaggcgctaaaccactttaggaataaattcgacgaagctttg
tcgaactcgtggaagacttcgttgaattgggcgtcgcataacttagcgaagaataataaa
gcatga

DBGET integrated database retrieval system