KEGG   Tribolium castaneum (red flour beetle): 657374Help
Entry
657374            CDS       T01046                                 

Definition
similar to Acetyl-coenzyme A synthetase (Acetate--CoA ligase) (Acyl-activating enzyme) (Acetyl-CoA synthetase) (ACS) (AceCS)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tca01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tca00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tca00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tca00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LGUn
AA seq 666 aa AA seqDB search
MPSEKSVYLPNPSVAKNAFVSSFAQYQEMYQKSIDNPEEFWGEIAKQFYWETPIDINSFF
RYNFDIRKGPIYTKWLDGATTNIAYNLLDRNVKNGFGDKVAFYWEGNHPDDYSRLTYKKL
LEEVCRFANVLRSKGVKKGDRVAVYMPMILEAVITLLGCARIGAVHSLVFAGFSADSFAE
RILDCEARVLVTADGVWRGEKLLSLKNICDQSMNKCAQKGHNVKTCIVVSHLGRVTSPSG
VQKNRNNKTPMQEGRDVWWHDIVPQASTDCVPEWVQAEDPLFMLYTSGSTGKPKGVVHTT
AGYLLYAATTFKYVFDYKPNDVYWCTADIGWITGHTYVVYGPLANCATSVLYEGTPFYPN
NDRFWLVVKKYKVNQFYTAPTAIRALMKFEDDLVKRVDLSSLKVLGSVGEPINPEAWMWY
YKLVGREKCSIVDTFWQTETGGHVLTPLPGATPMKPGAAAFPFFGVQPALLDESGNEIKG
EGEGYLVFARPWPGIMRTLYNNHPRYETTYFSKFPGYYCTGDGARRDADGYLWVTGRVDD
MLNVSGHLMSTAEVESVLTEHPNVAEAAVVAKPHPVKGECLYCFITTTDTTRFDDKLLTE
LKQLVRERIGPFAQPDVVQNAPALPKTRSGKIMRRILRKVAVNDRDVXXXXXXXXXXXXX
XXXXEL
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgaaaagtccgtttacctgcccaacccttccgtggcgaaaaatgcgttcgtc
tcgtccttcgcacaataccaggaaatgtaccagaaatcgatagacaaccctgaggagttc
tggggtgaaatcgccaagcaattctactgggagaccccgatcgacattaactcgtttttt
cgctacaattttgacatcagaaaggggcccatttacaccaaatggctggacggggcgacc
acgaatatcgcctataatttgctggatcgaaatgtgaaaaatgggttcggggacaaagtt
gcgttttattgggaggggaaccacccggacgattacagccgcctaacgtataaaaaatta
ctggaggaagtttgcagatttgcgaatgttttgcgaagtaaaggagtgaaaaaaggcgac
agggttgctgtttacatgcctatgatccttgaagctgtgataaccttactaggatgtgca
cggattggagcagttcattcccttgtgtttgcaggattttcggccgattctttcgccgaa
cgcatcctcgactgtgaagcccgcgttctcgtaacagcagacggcgtctggcgaggagaa
aaactcctctccttgaaaaatatctgtgatcaatcgatgaataaatgtgcacagaaaggc
cacaatgtgaaaacttgcatagtggtgtcgcacttgggccgcgttacttcgccatctggg
gttcaaaagaatcggaacaataaaacgcctatgcaagaaggtcgcgatgtttggtggcac
gatattgttcctcaagcgtcaactgattgtgtgccagagtgggttcaagctgaagatccc
ttgtttatgttgtacacgagtggttcaactgggaagcccaaaggtgtggtacacacaaca
gcggggtatttgttgtacgctgccaccacgtttaaatacgtgtttgattacaagcccaat
gatgtttattggtgtactgctgatattggctggatcactggacacacgtatgtggtgtat
gggccgttggcgaattgtgcaacttcggttctgtatgaaggaactccattttatccaaat
aatgacagattctggctagtcgttaaaaagtataaggttaatcagttttacactgcccct
actgccattagagctttaatgaaatttgaagatgatcttgttaaaagagtcgacctatcc
tctttaaaagtattaggctcagttggtgagccaataaaccctgaagcttggatgtggtat
tacaaactagtcggaagagaaaaatgttcaattgttgacaccttctggcagactgaaaca
gggggtcatgttttgacaccgcttcctggggcaactcctatgaaaccaggcgctgctgca
ttccccttctttggcgtccaaccagccctcttggacgagtccggcaacgagataaagggc
gaaggtgaaggttacctcgttttcgctcgcccttggcccggcataatgcgcaccctttac
aacaaccacccccgatacgaaaccacctacttctccaaattccctggctattactgcact
ggagacggtgctcgaagagacgccgacggctatctctgggtcacaggacgtgttgatgac
atgttgaacgtctccggacatttaatgtcaaccgctgaagtcgaatcggttctaaccgaa
cacccgaatgttgccgaggctgcagttgttgcaaaaccacacccagtcaaaggcgaatgc
ctttattgtttcatcacaacgacggacacgactcgctttgacgacaagttgttgactgag
ttgaagcagcttgtcagagagaggataggaccttttgcacagcctgatgttgtgcaaaat
gcgccagctttgcctaagacaaggtccgggaaaataatgcggaggattttgcggaaggtg
gctgttaatgaccgagatgtnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnaagagttatag

DBGET integrated database retrieval system