KEGG   Tribolium castaneum (red flour beetle): 657507Help
Entry
657507            CDS       T01046                                 

Definition
ubiquitin carboxyl-terminal hydrolase 14
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     657507
Peptidases [BR:tca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   657507
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG7
AA seq 492 aa AA seqDB search
MPQYKVKVKWGKESYPDIEVNTDESPMLFKAQLFALTGVQPERQKVMIKGVTLKDADWDN
FKLKDGVTVLLMGSKEEDVPKEPVEKTVFVEDMNESELATALELPAGLTNLGNTCYMNAT
VQCLKSVPELREALQAYQGDVTDARGVIPAQSITAALRDLYSSMDKGNNVPPIVLLQMLH
LAFPRFAEKNEHGGFTQQDANECWTELIRMLQQKLPAKQNGGNAAEKFKSLVDQFFGGTF
EVELKCTETEDEPVTKNKETFLQLSCFISQDVRYMHSGLRSKMQEQITKKSSTLDRDAVY
IKTSKISRLPAYLTIQFVRFYYKEKESINAKILKDVKFPIDFDAFDLCTPELQEKLAPMR
AKFKELEDAQVEAASKEKQKSIGDGKANEADKKYAPYWFEDDLGSNNSGYYTLQAVLTHR
GRSSSSGHYVGWVRQSGDKWIKCDDDNVSPVTTEDILKLSGGGDWHCAYVLLYGPRLLEI
PSESEEKMVTEN
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgccacaatacaaggttaaagtgaaatggggtaaggagtcttaccccgatattgaagtg
aacacggatgaatctccgatgctgtttaaggcgcagttgtttgccctcactggagtgcaa
cccgaaagacagaaagtcatgataaaaggggtgacgttgaaagacgccgattgggataac
tttaagttgaaggatggggttactgtgttattaatggggagtaaagaagaagacgtgcca
aaagaaccggtcgaaaaaaccgtttttgtggaagatatgaatgagagcgaattggctact
gccttggagcttcctgccggtttaacaaatctaggaaacacgtgttacatgaatgccaca
gttcagtgtttgaaatcagttcccgaactgcgagaagcccttcaggcctatcaaggagac
gtgaccgacgcaaggggcgtaatccccgcacagtcaattacggcagctttgcgcgatctt
tactcctccatggataaagggaacaacgtgccccccatagtccttctccaaatgctccac
ttggcattccccagattcgcggaaaagaacgaacatggcggttttacgcaacaggacgct
aacgaatgttggactgagttaattagaatgttgcaacagaaattgccggcgaaacaaaac
ggcggaaatgctgccgaaaagtttaaatcgttggttgatcaattttttggcgggactttt
gaagttgaattgaaatgcacggaaacggaagatgagccggtcactaaaaataaggagacg
tttctgcagctgagttgttttatttcgcaagatgtgcgctatatgcattcaggcttgaga
tcgaaaatgcaggagcaaataactaaaaaatcgtcaaccctggaccgggatgccgtttat
attaaaacatctaagataagcagattgccggcttatctcaccatccagttcgttcgattt
tactacaaggagaaggaatcaataaacgccaaaattctgaaagatgttaaattcccaata
gattttgacgctttcgatttatgtactcccgaattgcaggaaaagttagccccgatgagg
gcaaagttcaaggagttggaggatgcgcaagtggaagcggcgtcaaaagagaaacaaaaa
agcataggcgacggtaaagcgaacgaagcggataagaagtacgccccctattggttcgag
gatgatttggggagtaacaacagcggatattacacccttcaggctgtgttgacccatcgg
gggcggtcttcgtccagtggtcactacgtggggtgggtgcgccagtctggcgataagtgg
ataaagtgcgatgatgataatgtttcgcctgtgactactgaggatattttgaagctgtct
ggcggaggtgattggcactgcgcttacgtccttttgtacgggcctagactgttagaaatc
cccagcgaaagtgaggaaaaaatggtgacagaaaattaa

DBGET integrated database retrieval system