KEGG   Tribolium castaneum (red flour beetle): 657575Help
Entry
657575            CDS       T01046                                 

Definition
insect replication protein a-like
Orthology
K10739  
replication factor A2
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:tca03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:tca03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:tca03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tca03440]
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:tca03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG6
AA seq 227 aa AA seqDB search
MSSVQPRTQPVVPVIIDQILSCKHPSFQIAGKAVHITCLIGVISNIHVDSLEITCNIQDQ
SGKIKGAINCDSESEVNSKLVTLIEGKYSKIFASIRIQNCEKVVMIMKTFPVDDLNELSS
HLLNVLSVKFEAEAELNQELSCANTLADALEMGEDSATPRISEFQRLVFNIVKSDFSEFG
VTRRNVLKQFPSYQGHEVNQALEHLISQGAIYLTIDQDHLKAVTNFY
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagtgcagccccgcacccagcctgtggtccccgtaatcatcgaccagatcctt
tcctgcaaacacccttccttccaaattgcgggaaaagccgttcacattacttgtttaatc
ggcgtgatttcaaacattcacgtcgactctttggaaataacatgtaacatccaagatcag
tctggtaagatcaaaggagccattaattgcgactccgaatcggaagttaattcgaaactt
gtaactttgatcgaaggcaagtattcgaaaattttcgcttcgattcgcatccaaaactgc
gaaaaagtcgtaatgataatgaaaacattcccggttgatgatttaaatgagttgtcttcg
cacttattgaacgttttgagtgtgaaattcgaggcggaagctgagttaaaccaagaactg
agttgtgcaaatacacttgctgatgctttggagatgggtgaggactcggctacgcctcgt
attagtgagtttcaacgcttggtttttaatattgtgaagagtgatttttccgagtttggg
gtcacgagaaggaatgtcttgaaacagtttccttcgtatcaaggacatgaagttaaccaa
gctttggaacatttgatcagtcaaggcgctatttacctgactattgatcaagatcatctc
aaggccgttacgaatttttattaa

DBGET integrated database retrieval system