KEGG   Tribolium castaneum (red flour beetle): 657586Help
Entry
657586            CDS       T01046                                 

Definition
similar to CG30421-PA
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.1.2.15]
Organism
tca  Tribolium castaneum (red flour beetle)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG8
AA seq 859 aa AA seqDB search
MTLLPESPVPQSVELSKLKRTFTLPRNPFNASKRRPKDSDPEDKKVFRRPSIRKFINKIA
QHIGGVPVINGDSRVPPVGLQTWGPDDTPGVTGLKNHGNTCFINAVLQCISHTDVLAEYF
VLDRYKIDLSRRNKLNSKKFGTKGEITEQLALLLKALWACQYSPELSTSFKQVVERHGSQ
YKGNQQHDALEFLQWLLDKVHEDLNTASKKKYKLIKTSGRSDEVIAAETLENYKRCNNSF
IQGVFQAQYRSSLSCSRCRTQSNTFDPFQCISVQLPQFSKQSIYVTVLYTSQQPRQVQIG
LSLPSGATVSELRDILESDTSIERANMLITEIGETGFLRTFTDTQSVNIISEIDPIYCIE
VAQLKDLEEDTTSAYILLCWINVVQEGDGFKRFGSPYTMQVSRETSYEDLQKLLLKEMAP
ILHDDILTSAQPKGVFKIRISDPACNDNEPPCYLEPELEHPLFMEDVDQALALCSEEGGP
PHVKLVIEFTQSAKNAIIADDTDIIEEHSSVKQLKAQALQGGAPLTLEECLRDYTEAETL
TDAWRCPHCQQYQPVVKTLDMWSLPDILVVHFKRFRQQTLRGCSSAKLINMVDFPVYNLD
MSPHLANKGQNISEDQMIMTNGWSPFKRTRKQSNANDNMYDLYGICYHHGSDIETGHYTA
ACKNPYDNQWYLYDDAKVTNLSKQTDDISALLVNNSAYILFYQRRNVGSSTSSAASTSSV
GSSTDHWVSRMPKFVPPKNIKIEKKPKVDEETKTSEEVALRNSQNTLDSAANPRKSLDKS
TSTEEVKLYTTSIYINSCGEMDKEVSEGEVKVTMTEPEVRKVYTTTAAVHRHSDNVSRTR
LNWMSPQPVRKLNQSQQSV
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgacactcctcccagagtcccccgttccccaatccgtggaactctccaaactcaagcgg
accttcaccctgccccggaaccccttcaacgcgtcgaaacgccgccccaaagactccgac
cccgaggacaagaaagtcttcagacggccgtccatccgcaagttcatcaacaaaatcgcg
cagcacatcgggggcgtccccgtcatcaacggggactcgcgcgtgccgcccgtggggctc
cagacgtggggccccgacgacacgccgggcgtcacagggctcaagaaccacgggaatacg
tgcttcatcaacgctgtgctgcaatgcatctcgcatacggacgtcttggccgagtatttc
gttctggatcggtataaaatcgacctctcgaggcggaataaactcaattcgaaaaagttc
gggacgaagggcgagattacggaacagttggcgctgctgctgaaggccctgtgggcctgt
cagtacagccccgagctgagcaccagcttcaagcaagtggtggaaagacacgggagccaa
tacaagggcaaccaacagcacgacgccctcgagttcttgcagtggctgctggataaggtg
cacgaggacctcaatacggcttccaagaagaagtataagctgattaagacttccggccgt
tcggacgaggtgatcgccgccgaaaccctcgaaaactacaaacggtgcaacaattccttc
atccagggcgtgttccaggcccagtaccggtcatcgttgagttgttcccgttgccgcacc
caatccaacaccttcgatccgttccaatgtatctccgtgcaattgccccaattcagcaaa
caatcgatctatgtcacggtgttgtatacgtcgcagcagccaagacaggtccaaatcggt
ttgagtttaccatcgggagctaccgtttcagaattgagggatatcctcgaatcggacacg
tccatcgaacgtgccaatatgttaattaccgaaattggagaaacggggtttttgaggact
tttaccgacacgcaatcggtgaatattataagtgagattgatccgatctattgcatcgaa
gtagcgcaattgaaggatctggaagaggacacgaccagtgcgtatattttgttgtgttgg
attaatgtggttcaagagggagatggctttaagaggttcggcagcccctacacgatgcaa
gtctcccgcgaaacctcctacgaggacctccaaaaactcctcctcaaagaaatggccccc
atcctccacgacgacattctcacctcagctcaaccaaaaggcgttttcaaaatacgcatt
tcggatccggcttgtaacgacaacgagcctccttgttatctcgaacccgaactcgagcat
ccactttttatggaagatgtcgatcaagcgctggctttatgtagtgaagaagggggccca
ccacatgtcaaactcgtcatcgaatttacacagagtgccaaaaatgcaatcatcgccgac
gatacggacatcatcgaggaacattcgtccgtgaaacaattgaaagcgcaagcgctacaa
gggggcgcacctttgactttggaggagtgtttaagggattacaccgaagcggagactttg
acggacgcgtggcggtgcccccattgtcagcagtaccaaccggtggtgaaaacactggac
atgtggtcgttgccggacattttagtcgtgcattttaagcggtttcgacagcaaactttg
cggggctgtagcagcgccaagttgatcaatatggtggatttcccggtttataacctcgac
atgagcccccatttggccaataagggccaaaacatctccgaggaccagatgataatgacc
aatggttggagtccgtttaaacgtacccgtaaacaatcgaacgccaacgacaacatgtac
gacctttacggtatttgctaccatcatggtagtgatatcgaaaccggtcattacaccgcc
gcctgtaaaaacccctacgacaaccagtggtacctctacgacgacgcaaaagtcaccaac
ttgtcgaaacaaaccgacgacatcagcgccctcttggtcaacaacagtgcctacatcctg
ttttaccaacggcgtaacgttggctcgagtaccagcagtgcggccagtaccagttccgtg
ggctcctccaccgaccattgggtgtccagaatgcccaaatttgtaccaccgaaaaacatc
aaaatcgagaaaaagccgaaagttgacgaagaaacgaaaacgagcgaagaagtcgcgttg
cgtaattcacagaatacgctcgacagtgctgccaatccacgaaaatctctagacaagtcg
acgagtaccgaagaggttaagttgtatacgacgagtatttatattaattcttgcggcgaa
atggacaaggaggtgtcagagggtgaggtcaaggttacgatgacggagcccgaggtcagg
aaagtgtacacaacgacggctgcggtgcaccggcactcggataatgtgtcaaggacgagg
ctcaattggatgtcgccacagccggtacgaaaattgaaccaatcgcaacagtcggtttga

DBGET integrated database retrieval system