KEGG   Tribolium castaneum (red flour beetle): 657690Help
Entry
657690            CDS       T01046                                 

Definition
acyl-protein thioesterase 1
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    657690
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     657690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG1=X
AA seq 218 aa AA seqDB search
MAAPIVIAATAKHTATLIFLHGLGDTGQGWASAMAALRPPHVKVICPTAPTMPVTLNAGF
RMPSWFDLRTLDASGPEDEEGIKQAAKQVHSMIDNEIKDGIPAERIVVGGFSQGGALALY
SALVYPQQLAGVVSLSGWLPLHKSFPGSMKTSKDLPILQCHGDCDPVVPFKWGQMTASVL
KTLLKEPEFKSYRGLMHTSSDEELRDIKDFIDKQLPPH
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcagccccaattgttattgccgcaaccgctaaacacacagccacgttaattttttta
cacggtttgggggacacaggccaagggtgggccagcgccatggctgccctcagaccaccc
catgtgaaggtgatctgccccacggcccccaccatgccggtgactctgaacgcgggcttc
cggatgcccagctggttcgatttgcggacgcttgatgcctcaggccctgaagacgaagaa
gggattaaacaggccgctaaacaggtgcactcaatgatagataatgaaattaaggacggt
attccggctgaacgaatagttgtggggggtttctcgcaagggggcgctctcgcgctgtat
tcggcgcttgtgtacccccagcaattggccggggttgtgtctctatcggggtggttgccc
ttgcataagagctttcccggttccatgaaaacttcaaaagatttaccgattttgcagtgc
catggagattgcgaccccgtggtgcccttcaagtggggccaaatgaccgcgtctgtcctt
aaaaccttacttaaagaacccgaatttaagtcctaccggggacttatgcacacgtcttca
gatgaagagctgcgtgatataaaagactttattgacaagcaacttcctccacattaa

DBGET integrated database retrieval system