KEGG   Tribolium castaneum (red flour beetle): 657690Help
Entry
657690            CDS       T01046                                 

Definition
similar to CG18815-PA, isoform A
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:tca00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG1=X
AA seq 218 aa AA seqDB search
MAAPIVIAATAKHTATLIFLHGLGDTGQGWASAMAALRPPHVKVICPTAPTMPVTLNAGF
RMPSWFDLRTLDASGPEDEEGIKQAAKQVHSMIDNEIKDGIPAERIVVGGFSQGGALALY
SALVYPQQLAGVVSLSGWLPLHKSFPGSMKTSKDLPILQCHGDCDPVVPFKWGQMTASVL
KTLLKEPEFKSYRGLMHTSSDEELRDIKDFIDKQLPPH
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcagccccaattgttattgccgcaaccgctaaacacacagccacgttaattttttta
cacggtttgggggacacaggccaagggtgggccagcgccatggctgccctcagaccaccc
catgtgaaggtgatctgccccacggcccccaccatgccggtgactctgaacgcgggcttc
cggatgcccagctggttcgatttgcggacgcttgatgcctcaggccctgaagacgaagaa
gggattaaacaggccgctaaacaggtgcactcaatgatagataatgaaattaaggacggt
attccggctgaacgaatagttgtggggggtttctcgcaagggggcgctctcgcgctgtat
tcggcgcttgtgtacccccagcaattggccggggttgtgtctctatcggggtggttgccc
ttgcataagagctttcccggttccatgaaaacttcaaaagatttaccgattttgcagtgc
catggagattgcgaccccgtggtgcccttcaagtggggccaaatgaccgcgtctgtcctt
aaaaccttacttaaagaacccgaatttaagtcctaccggggacttatgcacacgtcttca
gatgaagagctgcgtgatataaaagactttattgacaagcaacttcctccacattaa

DBGET integrated database retrieval system