KEGG   Tribolium castaneum (red flour beetle): 657939Help
Entry
657939            CDS       T01046                                 

Gene name
Z9desB, GLEAN_16415, TcasZ9desB
Definition
Z9 acyl-CoA desaturase B
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:tca01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:tca01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEETLEBASE: 
UniProt: 
Position
LGUn
AA seq 350 aa AA seqDB search
MTPNASIPTGVLHENDEEVSNATLPPEVNKPDDRKLQLVWRNIILFAYLHLAALYGIWIM
FTSAKVATSLFGILLYQLGGFGITAGAHRLWAHRSYKAKWPLRLILTFCNTLAFEDSVID
WSRDHRVHHKFSETDADPHNAKRGFFFSHVGWLLCRKHPQVKEKGKQIDLSDLYADPILR
FQKKYYTIVMPLVSFVMPTVVPMYLWGETFKNAFLVNLFRYCLTLNATWLVNSAAHMWGD
KPYDRFINPAENFVVSVLALGEGWHNYHHTFPWDYKTSELGKYSVNFSTAFIDFFAKIGW
AYDLKTVSSEMIKKRVTRTGDGTHEIWGWGDKDQSQEDYQDAIITHRKSA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgacaccaaatgcttcaattccaactggtgttctccacgaaaatgacgaagaagtttcc
aatgcaacgcttccaccagaggtcaacaaaccggacgaccgcaaactgcagttagtttgg
aggaacatcattttgttcgcttatctgcatttggccgctttgtatggaatctggatcatg
ttcacctctgcaaaagtcgcaacgtctctatttggcattctactttaccaacttggaggt
ttcggaataacggctggagctcaccgtttgtgggctcatcgttcgtacaaagccaagtgg
cctttacgtctaatcctcactttctgcaacactttggcctttgaagattccgtcatcgat
tggtccagagaccaccgagtccatcacaagttctccgaaactgatgctgatccacataat
gccaaacgtggtttcttcttctctcacgttggctggcttttgtgccgtaaacatcctcaa
gtaaaagaaaagggcaaacaaatcgatctctccgacttgtacgctgatccgattttgcga
ttccagaagaaatactacaccattgtaatgcctttggttagttttgtaatgccaaccgtc
gtgccaatgtacctctggggtgaaaccttcaagaacgcctttctggtcaatctcttcaga
tattgtctaactttgaacgccacctggttggtcaattccgctgcccatatgtggggagat
aagccctatgataggtttatcaatccagctgagaatttcgtggtttcggttttggccttg
ggtgaaggttggcataactaccatcatactttcccttgggattacaaaacgtccgaattg
gggaaatacagtgtgaacttctcgaccgctttcattgatttcttcgccaagatcggatgg
gcttatgatttgaaaactgtttcatcggaaatgatcaagaaacgcgttacgagaactgga
gatggaacgcacgaaatttggggatggggtgataaggatcagtctcaggaagactaccaa
gacgcgattatcactcataggaagagtgcgtag

DBGET integrated database retrieval system