KEGG   Tribolium castaneum (red flour beetle): 658009Help
Entry
658009            CDS       T01046                                 

Definition
similar to Histone H2B
Orthology
K11252  
histone H2B
Organism
tca  Tribolium castaneum (red flour beetle)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LGUn
AA seq 245 aa AA seqDB search
MILFVCVVFFFSLLRLEILKNMPPKTSGKAAKKAGKAQKNISKSDKKKKRRRKESYAIYI
YKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLL
LPGELAKHAVSEGTKAVTKYTKXXXXXXXXXXXXXXXXXSGQVQVVEWEVWVGVWVEVGV
VVESGEVLPETESVVSNCVKEVLIEMGFIGDLVDVLEGSSKSICFVFFYPQYRVRAQVTQ
LTQNH
NT seq 737 nt NT seq  +upstreamnt  +downstreamnt
atgattttattcgtttgtgtcgtgttttttttttctttattaagattagaaatattaaaa
aatatgccaccaaagacaagcggtaaagcagcgaaaaaggctggaaaagctcaaaagaat
atttcgaagagcgacaagaaaaagaagcgcaggaggaaggaaagctatgcaatctatatt
tataaggtattgaagcaagtacaccccgataccggtatttcgagcaaggcgatgagcatc
atgaacagtttcgttaatgatatctttgaacggatcgccgctgaagcttctcgtcttgcg
cattacaacaagcgttcgacgattacgagccgggaaattcaaacagcggttcgtctcttg
ttgcctggtgaattggcaaagcacgcagtctctgaaggtaccaaagccgtcaccaaatac
acaaaannnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnngagc
ggtcaagtccaggtcgtcgagtgggaagtttgggtcggggtctgggtcgaggtcggcgtc
gtcgtcgagtcgggtgaggttttgcctgaaacggagagtgttgttagtaactgtgttaaa
gaagtgttgattgaaatggggttcattggggacttggtggatgttttggagggtagcagc
aaatcaatttgctttgtcttcttttacccccagtaccgagtgcgggcgcaagtgacccaa
ctaacccagaatcacag

DBGET integrated database retrieval system