KEGG   Tribolium castaneum (red flour beetle): 658014Help
Entry
658014            CDS       T01046                                 

Definition
choline/ethanolamine kinase
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    658014
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     658014
    2.7.1.82  ethanolamine kinase
     658014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG6
AA seq 379 aa AA seqDB search
MAKKVSGDSNEMREFAARICRDYLYGPWKSVTAQNIGFKHISGGLSNLLYHISLPESLVE
ESKDLGEPQEVLIRVYGQTHGEHALEALITESVVFTLLSERGLGPKLHGIFPGGRIEQYI
NARPLRTGELADEKLSVKIAQKMAAIHTMEVPLHKEPGWLWDTIDRWLRTCESKLKSDDV
PEFFRNSVDCDFLSEVDWLKKRLEMENCPVVFCHNDMQEGNILIRQDGPENNNNEDPQIV
VIDFEYCSYNYRSFDIANHFVEWVYDYTEAEYPFYKEQLENYPSKKQRLLFIKAYLEARG
LKENPKKILREVEVFTLASHFFWGIWGIINAGTSQIPFGYWEYAAARLRNYFQQKKKFTL
DMKPLVSSLPTKRKSCSLE
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaggtgtcgggtgactcgaacgaaatgagggaattcgctgcgagaatatgc
agggattatctctatgggccatggaaaagcgtcactgcacaaaacattggcttcaaacat
atcagcggcggcttgtccaacctcctgtaccacatatccttgccggaatccctcgtagaa
gagagcaaggacttgggcgaaccccaggaagtcctgatccgcgtctacggccaaacccat
ggcgagcatgcccttgaggccctcatcaccgaaagcgtcgtcttcacattactgagcgaa
agaggtctcggcccaaaactccacgggatttttccaggaggccgtatcgagcagtacatc
aatgccagaccattacgtaccggagaactcgccgacgagaagttgtcggtaaagattgca
cagaaaatggccgccatacatacaatggaggtgcccctgcacaaggagcccggttggctc
tgggacaccatcgatcgatggttgaggacgtgcgaatcgaagctgaaaagtgatgatgtt
cctgaatttttccgaaacagtgtcgattgcgactttttgtcggaagtcgattggctgaaa
aaacggctcgagatggagaattgtccggtcgttttttgccacaacgacatgcaagagggc
aatattttgatcagacaagacggacccgagaataataataacgaggatccgcagatcgtc
gtcatcgatttcgaatactgctcatacaactaccgttcgttcgacatcgccaatcatttc
gtcgaatgggtgtacgactacaccgaagcggaataccccttttataaagaacaactcgaa
aattacccatcgaagaaacaacggctcctattcatcaaagcctacttagaagcgcgcggt
ttgaaagaaaaccccaagaaaattctacgcgaagtggaagtcttcactcttgcctctcat
ttcttttgggggatttggggaattatcaacgcaggcacatcccaaatcccgttcggttac
tgggaatatgccgcagcccgtttgagaaattacttccaacagaaaaagaagttcacttta
gatatgaaaccgctagtgtcgtcacttccgactaaacgaaagagttgcagtctggagtga

DBGET integrated database retrieval system