KEGG   Tribolium castaneum (red flour beetle): 658084Help
Entry
658084            CDS       T01046                                 

Definition
(RefSeq) palmitoyl-protein thioesterase 1
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00062  Fatty acid elongation
tca01100  Metabolic pathways
tca01212  Fatty acid metabolism
tca04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    658084
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    658084
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     658084
Lipid biosynthesis proteins [BR:tca01004]
 Fatty acid synthase
  Component type
   658084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest Lipase_2 DCX
Motif
Other DBs
NCBI-GeneID: 658084
NCBI-ProteinID: XP_969590
UniProt: D6W6C0
Position
LG3
AA seq 304 aa AA seqDB search
MNGITFKYLILTLLFNILSANKVKDGNFTPIVMWHGMGDSCCFSFSLGAVKQKLEELLPG
VHVVSLRIGTSEVNDVENGYFLHPDKQINMACNLIQADPLLSDGFNAIGFSQGAQFLRGL
LQRCPKAHIKNLISLGGQHQGVYGLPNCGSLSHSICDYIRRLLNHAAYLEWVQKALVQAT
YWHDPLHEQEYKNYSTFLSDINNEITINTEYVQRLQTLDNFVLVKFDNDTIVEPRETEWF
GFYKPGQSSVIQNLKESPIYTEDRLGLRKLDEDSKLHFLGVIGNHLQFEWGWFQENILDS
YLKN
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaacggaattacttttaagtacttgatattaacacttttgtttaacattttaagtgct
aataaagttaaggacggcaattttacaccgatcgttatgtggcatggaatgggggacagc
tgttgtttttcgttcagtttaggagcagtaaaacaaaaactggaagaacttctgccgggt
gttcacgttgtttcattaagaatcggtacttctgaagtaaacgatgttgaaaatggctat
tttttgcaccctgacaagcaaattaacatggcttgtaatttaattcaggccgatcctctg
ctttctgacggttttaacgcaattggattttcacaaggagctcaatttttgcgtggactg
ttgcaacggtgcccaaaagcccacataaagaatttaatttcgttaggaggccaacaccag
ggtgtttacggcttacccaactgtggctccttatcacattcgatttgtgattacatcaga
agactgttgaatcacgctgcttatttggagtgggttcagaaagctttagttcaagccacg
tactggcacgatcctcttcatgagcaagagtataaaaattacagcacgttcttatccgac
attaacaacgaaatcacaattaatacagagtatgttcaaagactgcagaccttggataac
tttgttctagtcaagtttgataatgacaccattgttgagccaagagagacggaatggttc
gggttttataagccaggacaatcgtcggtcattcaaaacttgaaggaatcgccgatttat
accgaagatcgtcttggcctgagaaagctggatgaggactcaaaacttcactttttggga
gtaattgggaaccacctgcaattcgagtggggatggttccaggaaaatatacttgattct
tatttaaaaaattag

DBGET integrated database retrieval system