KEGG   Tribolium castaneum (red flour beetle): 658128Help
Entry
658128            CDS       T01046                                 

Definition
histone acetyltransferase KAT2A
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    658128
Enzymes [BR:tca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     658128
Transcription machinery [BR:tca03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     658128
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG5
AA seq 779 aa AA seqDB search
MSEQGQLSNNSANSEEGDAAGVPGGKPQAPSQTQNAAPTNKQPASRQTNLQRIQQKKQAV
LAFPYNKKLLKLAIYSKCQSENCICTGWKKTDPNMQEPTFTDPCRCEHPLEMHISHLRSK
TEDELNRLLRMVVDIDNMGTAMSREENIETKKVYTYLFHLLRKCILTLDTPVVESSLGQP
PFEKPCIHKAITNLLVYKFSHLAQQEWKTMYEVARILLHCLNTWEFPSPSSQKHIVSPEE
ATVYKMEHMRWLVFCNVPTFCDSLKHYDTTMVFGRTLLRAVFKYMRKQIMDQFNRERDKM
PQERRVMLLTHFPPFLNTLDEEIYAQDSPIWDPDFKQGPPQHFQNLFEAGKNKTNAKRGA
SDLDAKAGKTGDVPSRETKRRRAQDEQFEDIPMETVAQIIATIDDPNYMTGPDLIFSENA
PATDEAPKLLEKRKVIEMHVIGNSLTETVSKQTMLWFIGLQNVFSLQLPRMPIEYITQLL
FDPKHRTIALIKENRPIGGICFRPFETQGFTEIVFCAVTFSEQIKGYGTHLMNHLKDYHI
RKGILHFLTFADENAIGYFERQGFSKDIKLNRSIYQGYIKDYEGATLMHCELNPKIIYTE
FTSVVRRQKKFVKQLIYQQQRNVSKVHPGLTFFKEGVKSIPIESIPGLQETGWKPAARAT
RGAQQLEESQDIDVLADMLKSVLQAVKSHEDSWPFRLPVDKNDVPDYYDHIKYPMDLKTM
ADRLKSRYYVSRRLFIADMMRIFRNCKIYNSPETEYYQCAVNLQQYFQTKMKEVGLWDK
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacagggccagttgagtaacaatagtgccaattctgaagaaggggatgccgca
ggagtccctgggggtaaaccccaggctcccagtcagacacaaaatgcagccccaactaat
aaacaaccagcgtcgagacagacgaatttgcaaagaatacaacagaagaaacaggccgtt
ttggccttcccgtacaataaaaagttgctgaaacttgccatttattcaaaatgccagagc
gagaactgcatttgcaccggttggaaaaagaccgaccccaacatgcaagagcccactttt
accgacccctgtcgttgcgagcaccctttagaaatgcacatttcccacttacgcagtaaa
actgaggacgagttaaatcgtctcctgcgtatggttgtggacattgacaatatgggtacg
gcaatgagtcgtgaagaaaacattgaaacaaaaaaagtttacacgtacttattccacttg
ttgcgtaaatgcatcctaactcttgacactcccgtcgttgagagttcgctcggacagccc
ccatttgaaaaaccgtgcattcacaaagcgatcacaaatttgctagtttacaaattctca
catttggcccaacaagagtggaagacgatgtatgaagtggctaggattctcctccactgt
ttgaacacgtgggagtttccgagtccgagcagccagaagcatattgtaagtccggaggaa
gccacagtttataaaatggaacatatgcgttggttggtgttttgcaacgttccaacattt
tgcgactcgttgaaacattacgatacgacaatggtgtttgggaggacgcttctaagggct
gttttcaaatacatgaggaagcaaatcatggatcagtttaatcgagagcgggacaaaatg
ccccaagaacgtcgcgttatgctcctcacacattttcccccgtttctgaacacgttggat
gaagagatttacgcgcaggattccccgatttgggatcctgattttaaacaaggaccgccg
caacatttccagaatttattcgaagcggggaaaaacaaaacgaatgccaagcgaggagcg
agcgatttggacgcgaaagcgggcaaaactggggatgtaccgagtcgagagacgaaacgt
aggagggcacaggatgaacagtttgaggatattccgatggagacggttgcacaaattatt
gcaacaattgatgatccgaattacatgaccggacctgatctgattttctccgagaatgcg
cccgccacagacgaagcgcccaaacttttagaaaaacgcaaagtgattgaaatgcacgtc
attggtaacagtttgaccgaaacggtctcgaaacagaccatgttgtggttcattggtcta
caaaacgtcttttcgcttcaattgccccgaatgccgatcgaatacatcacccaattgtta
ttcgatccaaaacaccgcaccattgccctaattaaagaaaaccgtccaatcggcggtatt
tgtttccgcccgtttgaaactcaaggtttcacagagattgttttttgcgcggtcactttc
agcgaacagatcaaaggttacggaacgcatttaatgaaccatttgaaagactaccacatt
cgtaaaggcattctccactttctgactttcgcagacgagaacgcgattggttatttcgaa
cgtcagggattttcgaaagatattaaattaaaccggtcgatttatcaaggctatattaag
gactatgaaggcgccactctcatgcattgcgaactgaaccccaaaataatctacaccgag
ttcacttcagtcgttcggaggcaaaaaaagttcgtcaaacagttgatttatcagcagcaa
aggaacgtatcaaaggttcaccccggtctgactttcttcaaagagggggtgaagagcatc
cccattgagtccattccggggctgcaggagacaggctggaaaccggcagcgagggccacc
agaggggcgcaacaactggaggagtctcaagatattgacgtgttggctgatatgctcaaa
agtgtgcttcaagcggtgaaaagtcacgaagattcttggccgtttcgactgccagttgat
aaaaacgacgttccggattattacgaccacatcaagtatcccatggatttgaaaacaatg
gccgatcgcttgaagtcacggtattacgtttcaaggcgtttgtttatcgctgatatgatg
cggattttccgcaattgtaaaatttataattcgcctgagacagagtattaccagtgtgct
gtgaacttgcagcagtatttccagaccaagatgaaggaagtcggtttgtgggacaaataa

DBGET integrated database retrieval system