KEGG   Tribolium castaneum (red flour beetle): 658128Help
Entry
658128            CDS       T01046                                 

Definition
AGAP004434-PA-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:tca04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG5
AA seq 779 aa AA seqDB search
MSEQGQLSNNSANSEEGDAAGVPGGKPQAPSQTQNAAPTNKQPASRQTNLQRIQQKKQAV
LAFPYNKKLLKLAIYSKCQSENCICTGWKKTDPNMQEPTFTDPCRCEHPLEMHISHLRSK
TEDELNRLLRMVVDIDNMGTAMSREENIETKKVYTYLFHLLRKCILTLDTPVVESSLGQP
PFEKPCIHKAITNLLVYKFSHLAQQEWKTMYEVARILLHCLNTWEFPSPSSQKHIVSPEE
ATVYKMEHMRWLVFCNVPTFCDSLKHYDTTMVFGRTLLRAVFKYMRKQIMDQFNRERDKM
PQERRVMLLTHFPPFLNTLDEEIYAQDSPIWDPDFKQGPPQHFQNLFEAGKNKTNAKRGA
SDLDAKAGKTGDVPSRETKRRRAQDEQFEDIPMETVAQIIATIDDPNYMTGPDLIFSENA
PATDEAPKLLEKRKVIEMHVIGNSLTETVSKQTMLWFIGLQNVFSLQLPRMPIEYITQLL
FDPKHRTIALIKENRPIGGICFRPFETQGFTEIVFCAVTFSEQIKGYGTHLMNHLKDYHI
RKGILHFLTFADENAIGYFERQGFSKDIKLNRSIYQGYIKDYEGATLMHCELNPKIIYTE
FTSVVRRQKKFVKQLIYQQQRNVSKVHPGLTFFKEGVKSIPIESIPGLQETGWKPAARAT
RGAQQLEESQDIDVLADMLKSVLQAVKSHEDSWPFRLPVDKNDVPDYYDHIKYPMDLKTM
ADRLKSRYYVSRRLFIADMMRIFRNCKIYNSPETEYYQCAVNLQQYFQTKMKEVGLWDK
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacagggccagttgagtaacaatagtgccaattctgaagaaggggatgccgca
ggagtccctgggggtaaaccccaggctcccagtcagacacaaaatgcagccccaactaat
aaacaaccagcgtcgagacagacgaatttgcaaagaatacaacagaagaaacaggccgtt
ttggccttcccgtacaataaaaagttgctgaaacttgccatttattcaaaatgccagagc
gagaactgcatttgcaccggttggaaaaagaccgaccccaacatgcaagagcccactttt
accgacccctgtcgttgcgagcaccctttagaaatgcacatttcccacttacgcagtaaa
actgaggacgagttaaatcgtctcctgcgtatggttgtggacattgacaatatgggtacg
gcaatgagtcgtgaagaaaacattgaaacaaaaaaagtttacacgtacttattccacttg
ttgcgtaaatgcatcctaactcttgacactcccgtcgttgagagttcgctcggacagccc
ccatttgaaaaaccgtgcattcacaaagcgatcacaaatttgctagtttacaaattctca
catttggcccaacaagagtggaagacgatgtatgaagtggctaggattctcctccactgt
ttgaacacgtgggagtttccgagtccgagcagccagaagcatattgtaagtccggaggaa
gccacagtttataaaatggaacatatgcgttggttggtgttttgcaacgttccaacattt
tgcgactcgttgaaacattacgatacgacaatggtgtttgggaggacgcttctaagggct
gttttcaaatacatgaggaagcaaatcatggatcagtttaatcgagagcgggacaaaatg
ccccaagaacgtcgcgttatgctcctcacacattttcccccgtttctgaacacgttggat
gaagagatttacgcgcaggattccccgatttgggatcctgattttaaacaaggaccgccg
caacatttccagaatttattcgaagcggggaaaaacaaaacgaatgccaagcgaggagcg
agcgatttggacgcgaaagcgggcaaaactggggatgtaccgagtcgagagacgaaacgt
aggagggcacaggatgaacagtttgaggatattccgatggagacggttgcacaaattatt
gcaacaattgatgatccgaattacatgaccggacctgatctgattttctccgagaatgcg
cccgccacagacgaagcgcccaaacttttagaaaaacgcaaagtgattgaaatgcacgtc
attggtaacagtttgaccgaaacggtctcgaaacagaccatgttgtggttcattggtcta
caaaacgtcttttcgcttcaattgccccgaatgccgatcgaatacatcacccaattgtta
ttcgatccaaaacaccgcaccattgccctaattaaagaaaaccgtccaatcggcggtatt
tgtttccgcccgtttgaaactcaaggtttcacagagattgttttttgcgcggtcactttc
agcgaacagatcaaaggttacggaacgcatttaatgaaccatttgaaagactaccacatt
cgtaaaggcattctccactttctgactttcgcagacgagaacgcgattggttatttcgaa
cgtcagggattttcgaaagatattaaattaaaccggtcgatttatcaaggctatattaag
gactatgaaggcgccactctcatgcattgcgaactgaaccccaaaataatctacaccgag
ttcacttcagtcgttcggaggcaaaaaaagttcgtcaaacagttgatttatcagcagcaa
aggaacgtatcaaaggttcaccccggtctgactttcttcaaagagggggtgaagagcatc
cccattgagtccattccggggctgcaggagacaggctggaaaccggcagcgagggccacc
agaggggcgcaacaactggaggagtctcaagatattgacgtgttggctgatatgctcaaa
agtgtgcttcaagcggtgaaaagtcacgaagattcttggccgtttcgactgccagttgat
aaaaacgacgttccggattattacgaccacatcaagtatcccatggatttgaaaacaatg
gccgatcgcttgaagtcacggtattacgtttcaaggcgtttgtttatcgctgatatgatg
cggattttccgcaattgtaaaatttataattcgcctgagacagagtattaccagtgtgct
gtgaacttgcagcagtatttccagaccaagatgaaggaagtcggtttgtgggacaaataa

DBGET integrated database retrieval system