KEGG   Tribolium castaneum (red flour beetle): 658165Help
Entry
658165            CDS       T01046                                 

Definition
(RefSeq) protein unc-13 homolog B
  KO
K15293  
protein unc-13 A/B/C
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Membrane trafficking [BR:tca04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    658165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 2575 aa AA seqDB search
MSENVHRMADGTMAPVNYDANVDYVITEYMERLGTRLNILETELKYAWRALDLLSQEYIK
MWERLEKLEGLLYEQQSVISQLLDFYTTGGCRNMGAGATAGELEVIREILGNGTVEDGLE
EGQDVSRTQELELEELHVPDEAFYRSLNQAYREDLGGQGSQLGMIWEEKEETDDNNEKKN
DCCLVEGEEVFSALDYKDYRGNSPCVSEQDIAQLSRIDSIDHVAIEKLNELDRLSSKLQQ
DSDNIKQLQRKLLESPLSMSQDDEPKDDPNWSFSNSNQTDLLILKTELPNFAPRPSSRLS
VTDSVIATDNEVAEVLAGGLRGSTPTSPRRVASCTAPFTTVTGRLAYSAAVQNIDSKNPF
YSSLVAASYETIPCSTPSIFNARAETAPSPSLSIRTRQDGYIATNDQKGSPSPPPPAPEP
NPVFLATEPAPQQSIKSPKSSPKRKNVVKSDSGLSSMSGWSSLEKSPGSPKINKGHHHDN
TILPGGHHLSAFTTVKSPCSLETSEGYGTFVPAPAPASDINVSPRRKKHTKANSFTWNDQ
PAIYSVAGSNRETYTSVYTSNSADYITQTINYPDLVEPYENNELQRTTSGTTERRRSLSR
MFSTSNGDGVANHEGYKTAMQRTMFPTGNITDALSYYPTSTRYDEYNEAWLNPQEQQESP
SSSMRSTEPSEYNQSPYLDQRRIYENQDRWNQRQEIPYLELDLRNRNVPEYVVQQNENKF
FDPSSVIITQSGYITINSDTIDSSREEKKKFKRGNTLKSAMSSVSHWLPDLHLTKRHRSY
SLPSGVRREDLSKPKSNVGGRKKKKNAIVSTVSGILQKAKRKSYFHHHTQSLSDPEQSEN
EWVLQRASSVVSEDDRSEDSYSMFEGQAERDLFAKVAKPKPEDLQVVKVSPPPLNDHVEE
EVSGGSASSSIFPTVGEPSKKSSESEKSDETVITESKMVVVVGGASMEFAVSRALGKYRQ
QKQTSLPDDLSLEEPQGVVIEEIVEEEPKVDKLVEQISTESEVSHTEPVLRAQNRYLPKH
QQSLEIPGHKEDDDSRSTHSWRSTSRVSSRRQSTEDSIDSEDEWYCYELRKLEEMERQSQ
LEAEMGETLREEPELEEEYEPFEEVKERMSFVLRELRMKAKVVEGVLEEGDNNLHTLQEA
KNRERKSIHLEEAHMLFDKIAQNIKEEEEEQAKDEEHSSGETSGPDSPQQSENEEENTEE
FARCHVTPREEEQAEEASAVPEIQVEPEVAKPETKETAGSKWKLLKALKERKAEEKSNQD
KVEPASEKDKNGSGLGGDSGGRTNGHPGDNPFYSNIDSMPDIRPRRKSIPLVSDLVLKTM
AATKRNAGLTSAVPRATLNDEELKMHVYKKTLQALIYPISSTTPHNFVPWTATSPTYCYE
CEGLLWGIARQGVRCTECSVKCHEKCKDLLNADCLQRLLKLRAVVNRLKLFKSWMFLGAA
EKSSKHGAEDKANSIITAMKERMKQREREKPEIFELIRAVFGVEDKSHAGHMKAVKQSVL
DGTSKWSAKIAITVKSAQGLIAKDKSGTSDPYVTVQVGKVKKRTRTMPQELNPVWDEKFY
FECHNSSDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKR
TDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHYLCEQNSGVVSLPQAKGDDA
WKVYFEEAGEEIVDEFAMRYGIESIYQAMTHFHCLSTKYLCPGVPAVMSMLLANINAYYA
HTTASSAVSASDRFAASNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSPDKLMDLKST
VDLLTSITFFRMKVQELTCPPRASTVVKDCVKACLRSTYQFLFENTYELYNREFQSDPNE
PKRDPEDHGPRLDSVDFWHKLIALIVSVIEEDKNSYGPVLNQFPQELNIGQLSAATMWSL
FAVDMKYALEEHEQHRLCKSSAYMNLHFKVKWLYSNYVKDVPPYKGAVPEYPAWFEPFVM
QWLNENDDVSLEYLHGAFNRDKKDGFQRSSEHALFSNSVVDVFTQLTQCFDVVSKLECPD
PEIWKRYMKRFAKTIVKVLIAYADIVKGEFPEHVKEERIACILMNNIQQLRVQLEKMFES
MGGEKLEEDAANILKDLQQTLNGCLDELATQFASSLEPRITVSVKELGDLLLSIKGGGQP
GTTQPAQRNVVASEADEVLRPLMDLLDGSLSLYAQSCEKTVLKRLLKELWKIVMRILEKT
VVLPPMTDKTMMFKSLTDNAKNLAAKTKIEDMSTLFKNHMAGKQDVKNALSGVMDISKEV
EKNLSPKQCAVLDVALDTIKQYFHAGGNGLKKAFLDKSPELQSLRYALSLYTQTTDTLIK
TFVTTQINEVPLNNKETMLQRQISIERDETETGLEALEEPLKAKKRRESRQDTLDGQEGS
VGEVSIQVDLFTHPGTGEHKVTVKVVAANDLKWNVVSGMFRPFVEVNLIGPHLSDKKRKH
ATKSKANNWSPKYNETFHFTIGNEEQLDYFELHICVKDYCFAREDRLVGVAVMQLKDIVE
KGSCACWLSLGKRIQMDETGWTILRILSQRTNDEVAKEFVKLKSDIRQENPLPNQ
NT seq 7728 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaacgtgcaccggatggccgacggtaccatggcacccgtcaactacgacgcc
aacgttgactatgtcatcaccgaatacatggaacggctcggaaccagactcaacatcctt
gaaacggagctgaaatacgcctggcgtgcccttgatttactctcacaggagtatatcaaa
atgtgggagaggttggagaagttggaggggttgttgtacgagcaacagagtgtcatttcc
caattgttggatttttacaccacggggggctgtcgcaacatgggggcgggagcaacagct
ggggaactggaagtgattcgtgagattctgggcaatgggactgtggaggacgggctggag
gaggggcaagacgtgtcaaggacacaagagttggagttggaggagttgcatgtgccggat
gaggcgttctatcgcagcttgaaccaggcgtatcgggaggacttgggggggcaagggtca
cagttggggatgatttgggaggagaaggaggaaactgacgacaacaatgagaagaaaaat
gattgttgtttggttgaaggcgaggaggtttttagtgctttggactacaaggactatcgg
gggaattccccgtgtgttagtgaacaggatatagctcaattgtcacgcattgactccata
gatcacgtcgccattgaaaaattaaacgaactggaccgtttgagcagtaaattgcaacaa
gactcagataatattaaacaacttcaacgtaaactcctcgaatctcctctttccatgtcg
caagacgacgaaccaaaagacgatcctaactggagtttctccaattccaaccaaaccgac
ctcctcatcctcaaaaccgaacttccaaacttcgccccacgtcctagttcccgcctctcc
gtcactgatagtgtcattgccactgataacgaagtcgccgaagtgctcgccggtggttta
cgcgggagcacccccacgtccccccggcgcgtcgcctcctgcaccgcccccttcaccacc
gtcaccggccgcctcgcctacagcgccgctgtccaaaacatcgactccaaaaacccgttt
tacagtagtctagtggccgcctcctacgagaccatcccctgctccaccccttcgatcttc
aacgcgcgcgccgaaaccgccccctcgccctccctctccatccgcacgcgccaagacggc
tacattgcaacgaacgaccagaaaggttcaccgagtccgcccccaccggcccccgagccc
aacccagtcttcctagccactgagccggcgccacagcagtcaattaagtcgcccaaaagc
tcccccaagcgcaaaaacgtcgtcaaatccgactcagggctgtcgtcaatgagtgggtgg
tcaagtctcgagaaatcaccaggaagtccgaaaatcaacaaagggcaccaccatgacaac
accatcctacctggtggccaccacctttcggcgttcacgacggtgaagtcaccgtgtagt
ttggagacgagcgaagggtacggtacttttgtcccagcaccggccccagcctccgatatt
aatgtgagtccaaggaggaaaaaacacaccaaggcgaattctttcacttggaacgaccaa
ccagcgatttactccgtggcggggagcaaccgcgagacttacacttctgtctatactagt
aacagtgccgattatatcacccagactatcaattacccggatttggtcgagccttacgaa
aacaacgaattgcaacgaactacttcaggtaccaccgagaggaggaggtcactctcgagg
atgttctccacgagtaacggcgacggggtcgctaaccatgaaggttacaagacggcaatg
caacgcacgatgttccccaccggtaacatcaccgacgccttgtcgtactacccgacctcc
accagatacgacgagtacaacgaggcctggcttaacccccaagaacaacaagaaagtccg
agcagttccatgcgttccacggaaccctcggagtacaaccaaagcccctacctggaccag
aggagaatctacgagaaccaggacaggtggaaccaacggcaggagatcccttacttggag
ctcgacctccggaaccggaacgtccctgaatatgtggtccaacaaaacgagaacaagttc
tttgaccccagctcggtcataatcactcagtcgggctatattaccatcaattcggacaca
atcgactcatcccgggaggaaaaaaagaaattcaagcggggtaatacgttaaaatcggcc
atgagttcggtaagtcattggttaccagacctgcacctcaccaagcgacaccgctcgtat
tccttaccgtcgggggtcaggcgggaggatttgtccaaacctaaaagtaacgtcggcggt
cgcaagaagaagaaaaacgcgattgtgtccacggtttcggggattttgcaaaaagccaag
cggaaaagctacttccaccaccacacccagtcactctctgaccccgaacagtccgagaac
gagtgggtgttacaacgggccagttctgtggtctctgaagatgatagaagtgaggatagt
tacagtatgtttgaaggacaagctgagcgagacctcttcgccaaagtggcgaaacccaaa
cccgaggacctccaagtggttaaagtgtctccaccaccactcaacgaccacgtggaggag
gaagtctccggcgggagcgcctccagtagcattttccccacggtcggcgaaccgtcgaag
aagagttccgagtcggagaaaagtgacgaaacggtcatcaccgaaagcaagatggtcgtg
gtggttggaggcgcctccatggagttcgccgtgtcccgagccttgggcaaataccgccaa
cagaagcaaacctctctccccgacgatctctccttggaggaaccccaaggggtcgtgatc
gaggaaatcgtcgaagaggaaccaaaagtggacaagttggtcgaacaaatcagtactgaa
agcgaagtcagtcacacggaaccggtcctaagggcccaaaatcgctacttgcccaaacac
caacaaagtttggaaataccaggacataaggaggacgatgacagtcggagcacgcactcc
tggcggagcacctcccgagtgtcctcgcgccgccaaagcaccgaagacagcatcgacagt
gaggacgagtggtattgctacgagttgcggaagctggaggagatggaacgtcagtcgcag
cttgaagccgagatgggtgaaaccctccgggaggagcccgagttggaggaggagtacgaa
ccgttcgaggaggtcaaggagcggatgtccttcgtgttgcgagagctacgcatgaaggcc
aaggtcgtggagggggttctggaggagggcgacaacaacctccacaccctccaagaggcg
aagaaccgcgaacgcaaatccatccatttggaggaggcgcacatgttgttcgacaaaatc
gcccaaaacatcaaggaggaggaggaggagcaagccaaggacgaggaacactcctcgggg
gagacctccgggccggactccccccagcagagcgagaacgaggaggagaacacggaggag
tttgccaggtgtcacgtcaccccccgtgaggaggagcaagctgaggaggcttccgccgtc
cccgaaatccaggtcgaaccggaagtggcgaagcccgagaccaaggaaaccgccgggagt
aagtggaagctcttgaaggctttgaaggagcggaaggcggaggagaagagcaaccaggac
aaggttgagccagctagtgagaaggacaaaaacgggtctggacttggaggcgattccggc
ggacggacaaatggccatccaggagataatccattctacagtaacatcgacagtatgccg
gatatccggccacgacggaagtccataccgttggtttccgacttggtgctcaagacaatg
gcagcgacgaaacgaaacgctggtttgacgtcagcagttcctcgagcaactctcaacgat
gaagaactgaaaatgcacgtttacaagaaaaccctccaggcgctgatttaccccatcagc
agcaccaccccccataacttcgtcccgtggacggccacctcccccacctactgctacgag
tgcgaggggctgttgtggggcatcgctcggcagggggtgcgctgcaccgagtgctcggtg
aagtgccacgagaagtgcaaagacctcctcaacgccgattgcctgcaaagattactaaag
ctaagggcggttgtgaatcgattaaaattgttcaaatcgtggatgtttctaggagccgct
gagaaaagttccaaacatggagctgaagataaagccaacagtattataacagcaatgaag
gagcgaatgaagcaaagggaacgagagaagcctgagatcttcgaacttatcagggccgta
ttcggcgtagaagacaagagtcacgccggtcatatgaaagccgtcaaacaatccgttcta
gatggtacctccaagtggtcagcaaagatagccatcacagtcaaatccgcacaaggactc
atcgccaaggacaagagcggcacctccgacccctacgtcaccgtccaggtcggcaaagtc
aaaaaacgcacaaggaccatgccccaggagctgaaccccgtctgggacgagaagttttat
ttcgagtgccacaactcctccgaccggatcaaagtgcgcgtttgggacgaagacaacgac
cttaagagcaaactcagacagaagctgaccagggaatcggacgatttcctcggacagact
attatagaagtgcggactttgtccggagagatggacgtttggtacaatttggagaaacga
acggacaagtccgccgtttccggcgcgattcgcttacacatatcggtggagatcaagggg
gaggaaaaagtggccccatatcatgtacagtacacttgccttcacgagaacttgttccat
tatctgtgcgagcagaacagcggagttgtgagtctgccgcaggccaagggggacgatgcc
tggaaggtgtactttgaggaggctggggaggagattgtggacgagtttgcaatgcggtac
gggatcgagtcgatttatcaggcgatgacgcattttcactgcctctcgaccaagtatctg
tgtccgggggtgccagctgtgatgagtatgctgctggcgaatattaatgcctattacgca
cacacgacggcttcgtcggccgtttcggcgagcgatcgattcgctgcctccaattttggg
aaagagaaattcgtaaaactcctcgaccagctgcacaactccctccgcatcgacttatcc
atgtaccgcaacaacttcccggcttcgagccccgacaaactaatggacttgaaatccacc
gtcgacctcctcaccagcatcaccttcttccggatgaaggtccaggagttgacatgtcca
ccacgtgccagcaccgtcgtcaaagactgcgtcaaagcctgtctccgctccacatatcaa
ttcctcttcgaaaacacctacgagttgtacaatcgcgagttccaaagcgaccccaatgag
cccaagcgcgaccccgaagaccacggcccacgcctcgacagcgtcgacttctggcacaag
ctcatcgcacttattgtgtccgttatcgaagaagataagaacagttatgggccggtgctg
aaccagttcccccaggagctgaatatcggacaactttcggcagccaccatgtggagtttg
tttgctgtggatatgaagtacgctctggaggagcatgaacagcatcgactgtgcaaaagc
tcggcttatatgaacttacatttcaaggtgaaatggctgtactcgaattatgtcaaagat
gtgcctccttataaaggtgcagtgcctgaatatcctgcatggttcgagcccttcgtcatg
cagtggttgaatgagaacgacgacgtttccctcgaataccttcacggtgccttcaataga
gacaaaaaggacggcttccaaagaagcagcgaacacgccctcttttccaattccgtcgtg
gacgtcttcacccaactgacccaatgcttcgacgtcgtctccaaactggaatgtccagac
ccggagatctggaagcgctacatgaaacgcttcgccaaaaccatcgtcaaggtgctaata
gcgtacgctgacatcgtcaaaggggagttccccgaacacgtgaaagaggaacgaattgct
tgcattcttatgaacaatatccaacaattacgggtacaattggagaagatgttcgagtca
atggggggcgaaaagttggaagaagacgctgcgaacattctcaaggacttgcaacaaacc
ctgaacgggtgtttggacgaattggccacgcagttcgcctccagccttgagccgcgcatt
accgtcagtgtgaaggaactaggcgacctccttttgagtattaaaggaggaggtcagcct
ggaaccacccaaccagcgcagagaaacgtcgtagcatcggaagctgacgaagtgttgcga
cctctcatggacctccttgacggttcgctctccctctatgctcaatcgtgcgagaagact
gtcctcaaacgcctcctcaaagagttgtggaagatcgtgatgaggatccttgagaaaacg
gtggtcttgccaccaatgacggacaaaacgatgatgttcaagagcctgactgacaatgcg
aaaaacctcgccgccaaaaccaaaatcgaggacatgtccacactgttcaaaaaccacatg
gcgggcaaacaggacgtgaagaacgccctcagcggcgttatggacatttcgaaggaggtg
gagaagaacctctcccccaagcagtgtgcggtgctggacgtggccttggacaccatcaag
cagtacttccacgcgggcgggaacggcctgaagaaggccttcttggacaaaagcccagaa
ttgcaaagtttgcgttacgccttatctctctatacgcaaacgactgacactcttatcaaa
actttcgtcacgacgcaaattaacgaagtgccgcttaacaataaagaaacaatgctccaa
cgacaaatttcgatcgagcgtgacgagaccgagacgggacttgaagcgttagaagaacca
ttgaaggctaaaaaacgaagagaaagtcgacaagacactttggatggccaagagggcagt
gttggcgaagtgtcgattcaagtggatctattcacacatccaggcacaggcgagcacaaa
gttaccgtcaaagttgttgccgccaatgatttgaaatggaacgtcgtttcgggaatgttc
cgaccgttcgtggaagtgaatctgattggtccgcacctctccgacaagaagcggaaacac
gcgacgaaatccaaggccaataactggtcgccgaagtataacgagacgtttcattttact
attggtaacgaggagcagttggactacttcgagttgcacatttgcgtcaaggactattgt
ttcgctcgcgaggaccgacttgtgggcgtggccgtgatgcagctcaaggacatcgtggag
aagggctcgtgcgcctgctggctgtcattgggtaaacgcatccaaatggacgagactggt
tggacgattctgcgcatcctctctcaacgcacaaatgatgaagtggcgaaggagtttgtc
aaattgaaatcggatatacgtcaggaaaacccccttccgaaccagtaa

DBGET integrated database retrieval system