KEGG   Tribolium castaneum (red flour beetle): 658165Help
Entry
658165            CDS       T01046                                 

Definition
similar to unc-13 CG2999-PC
Orthology
K15293  
protein unc-13
Organism
tca  Tribolium castaneum (red flour beetle)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LGUn
AA seq 2512 aa AA seqDB search
MSENVHRMADGTMAPVNYDANVDYVITEYMERLGTRLNILETELKYAWRALDLLSQEYIK
MWERLEKLEGLLYEQQSVISQLLDFYTTGGCRNMGAGATAGELEVIREILGNGTVEDGLE
EGQDVSRTQELELEELHVPDEAFYRSLNQAYREDLGGQGSQLGMIWEEKEETDDNNEKKN
DCCLVEGEEVFSALDYKDYRGNSPCVSEQDIAQLSRIDSIDHVAIEKLNELDRLSSKLQQ
DSDNIKQLQRKLLESPLSMSQDDEPKDDPNWSFSNSNQTDLLILKTELPNFAPRPSSRLS
VTDSVIATDNEVAEVLAGGLRGSTPTSPRRVASCTAPFTTVTGRLAYSAAVQNIDSKNPF
YSSLVAASYETIPCSTPSIFNARAETAPSPSLSIRTRQDGYIATNDQKGSPSPPPPAPEP
NPVFLATEPAPQQSIKSPKSSPKRKNVVKSDSGLSSMSGWSSLEKSPGSPKINKGHHHDN
TILPGGHHLSAFTTVKSPCSLETSEGYGTFVPAPAPASDINVSPRRKKHTKANSFTWNDQ
PAIYSVAGSNRETYTSVYTSNSADYITQTINYPDLVEPYENNELQRTTSGTTERRRSLSR
MFSTSNGDGVANHEGYKTAMQRTMFPTGNITDALSYYPTSTRYDEYNEAWLNPQEQQESP
SSSMRSTEPSEYNQSPYLDQRRIYENQDRWNQRQEIPYLELDLRNRNVPEYVVQQNENKF
FDPSSVIITQSGYITINSDTIDSSREEKKKFKRGNTLKSAMSSVSHWLPDLHLTKRHRSY
SLPSGVRREDLSKPKSNVGGRKKKKNAIVSTVSGILQKAKRKSYFHHHTQSLSDPEQSEN
EWVLQRASSVVSEDDRSEDSYSMFEGQAERDLFAKVAKPKPEDLQVVKVSPPPLNDHVEE
EVSGGSASSSIFPTVGEPSKKSSESEKSDETVITESKMVVVVGGASMEFAVSRALGKYRQ
QKQTSLPDDLSLEEPQGVVIEEIVEEEPKVDKLVEQISTESEVSHTEPVLRAQNRYLPKH
QQSLEIPGHKEDDDSRSTHSWRSTSRVSSRRQSTEDSIDSEDEWYCYELRKLEEMERQSQ
LEAEMGETLREEPELEEEYEPFEEVKERMSFVLRELRMKAKVVEGVLEEGDNNLHTLQEA
KNRERKSIHLEEAHMLFDKIAQNIKEEEEEQAKDEEHSSGETSGPDSPQQSENEEENTEE
FARCHVTPREEEQAEEASAVPEIQVEPEVAKPETKETAGSKWKLLKALKERKAEEKSNQD
KVEPASEKDKNGSGLGGDSGGRTNGHPGDNPFYSNIDSMPDIRPRRKSIPLVSDLVLKTM
AATKRNAGLTSAVPRATLNDEELKMHVYKKTLQALIYPISSTTPHNFVPWTATSPTYCYE
CEGLLWGIARQGVRCTECSVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKANSIITAMKE
RMKQREREKPEIFELIRAVFGVEDKSHAGHMKAVKQSVLDGTSKWSAKIAITVKSAQGLI
AKDKSGTSDPYVTVQVGKVKKRTRTMPQELNPVWDEKFYFECHNSSDRIKVRVWDEDNDL
KSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISVEIKGE
EKVAPYHVQYTCLHENLFHYLCEQNSGVVSLPQAKGDDAWKVYFEEAGEEIVDEFAMRYG
IESIYQAMTHFHCLSTKYLCPGVPAVMSMLLANINAYYAHTTASSAVSASDRFAASNFGK
EKFVKLLDQLHNSLRIDLSMYRNNFPASSPDKLMDLKSTVDLLTSITFFRMKVQELTCPP
RASTVVKDCVKACLRSTYQFLFENTYELYNREFQSDPNEPKRDPEDHGPRLDSVDFWHKL
IALIVSVIEEDKNSYGPVLNQFPQELNIGQLSAATMWSLFAVDMKYALEEHEQHRLCKSS
AYMNLHFKVKWLYSNYVKDVPPYKGAVPEYPAWFEPFVMQWLNENDDVSLEYLHGAFNRD
KKDGFQRSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKRYMKRFAKTIVKVLIA
YADIVKGEFPEHVKEERIACILMNNIQQLRVQLEKMFESMGGEKLEEDAANILKDLQQTL
NGCLDELATQFASSLEPRITVSVKELGDLLLSIKGGGQPGTTQPAQRNVVASEADEVLRP
LMDLLDGSLSLYAQSCEKTVLKRLLKELWKIVMRILEKTVVLPPMTDKTMMFKSLTDNAK
NLAAKTKIEDMSTLFKNHMAGKQDVKNALSGVMDISKEVEKNLSPKQCAVLDVALDTIKQ
YFHAGGNGLKKAFLDKSPELQSLRYALSLYTQTTDTLIKTFVTTQINEDTLDGQEGSVGE
VSIQVDLFTHPGTGEHKVTVKVVAANDLKWNVVSGMFRPFVEVNLIGPHLSDKKRKHATK
SKANNWSPKYNETFHFTIGNEEQLDYFELHICVKDYCFAREDRLVGVAVMQLKDIVEKGS
CACWLSLGKRIQMDETGWTILRILSQRTNDEVAKEFVKLKSDIRQENPLPNQ
NT seq 7539 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaacgtgcaccggatggccgacggtaccatggcacccgtcaactacgacgcc
aacgttgactatgtcatcaccgaatacatggaacggctcggaaccagactcaacatcctt
gaaacggagctgaaatacgcctggcgtgcccttgatttactctcacaggagtatatcaaa
atgtgggagaggttggagaagttggaggggttgttgtacgagcaacagagtgtcatttcc
caattgttggatttttacaccacggggggctgtcgcaacatgggggcgggagcaacagct
ggggaactggaagtgattcgtgagattctgggcaatgggactgtggaggacgggctggag
gaggggcaagacgtgtcaaggacacaagagttggagttggaggagttgcatgtgccggat
gaggcgttctatcgcagcttgaaccaggcgtatcgggaggacttgggggggcaagggtca
cagttggggatgatttgggaggagaaggaggaaactgacgacaacaatgagaagaaaaat
gattgttgtttggttgaaggcgaggaggtttttagtgctttggactacaaggactatcgg
gggaattccccgtgtgttagtgaacaggatatagctcaattgtcacgcattgactccata
gatcacgtcgccattgaaaaattaaacgaactggaccgtttgagcagtaaattgcaacaa
gactcagataatattaaacaacttcaacgtaaactcctcgaatctcctctttccatgtcg
caagacgacgaaccaaaagacgatcctaactggagtttctccaattccaaccaaaccgac
ctcctcatcctcaaaaccgaacttccaaacttcgccccacgtcctagttcccgcctctcc
gtcactgatagtgtcattgccactgataacgaagtcgccgaagtgctcgccggtggttta
cgcgggagcacccccacgtccccccggcgcgtcgcctcctgcaccgcccccttcaccacc
gtcaccggccgcctcgcctacagcgccgctgtccaaaacatcgactccaaaaacccgttt
tacagtagtctagtggccgcctcctacgagaccatcccctgctccaccccttcgatcttc
aacgcgcgcgccgaaaccgccccctcgccctccctctccatccgcacgcgccaagacggc
tacattgcaacgaacgaccagaaaggttcaccgagtccgcccccaccggcccccgagccc
aacccagtcttcctagccactgagccggcgccacagcagtcaattaagtcgcccaaaagc
tcccccaagcgcaaaaacgtcgtcaaatccgactcagggctgtcgtcaatgagtgggtgg
tcaagtctcgagaaatcaccaggaagtccgaaaatcaacaaagggcaccaccatgacaac
accatcctacctggtggccaccacctttcggcgttcacgacggtgaagtcaccgtgtagt
ttggagacgagcgaagggtacggtacttttgtcccagcaccggccccagcctccgatatt
aatgtgagtccaaggaggaaaaaacacaccaaggcgaattctttcacttggaacgaccaa
ccagcgatttactccgtggcggggagcaaccgcgagacttacacttctgtctatactagt
aacagtgccgattatatcacccagactatcaattacccggatttggtcgagccttacgaa
aacaacgaattgcaacgaactacttcaggtaccaccgagaggaggaggtcactctcgagg
atgttctccacgagtaacggcgacggggtcgctaaccatgaaggttacaagacggcaatg
caacgcacgatgttccccaccggtaacatcaccgacgccttgtcgtactacccgacctcc
accagatacgacgagtacaacgaggcctggcttaacccccaagaacaacaagaaagtccg
agcagttccatgcgttccacggaaccctcggagtacaaccaaagcccctacctggaccag
aggagaatctacgagaaccaggacaggtggaaccaacggcaggagatcccttacttggag
ctcgacctccggaaccggaacgtccctgaatatgtggtccaacaaaacgagaacaagttc
tttgaccccagctcggtcataatcactcagtcgggctatattaccatcaattcggacaca
atcgactcatcccgggaggaaaaaaagaaattcaagcggggtaatacgttaaaatcggcc
atgagttcggtaagtcattggttaccagacctgcacctcaccaagcgacaccgctcgtat
tccttaccgtcgggggtcaggcgggaggatttgtccaaacctaaaagtaacgtcggcggt
cgcaagaagaagaaaaacgcgattgtgtccacggtttcggggattttgcaaaaagccaag
cggaaaagctacttccaccaccacacccagtcactctctgaccccgaacagtccgagaac
gagtgggtgttacaacgggccagttctgtggtctctgaagatgatagaagtgaggatagt
tacagtatgtttgaaggacaagctgagcgagacctcttcgccaaagtggcgaaacccaaa
cccgaggacctccaagtggttaaagtgtctccaccaccactcaacgaccacgtggaggag
gaagtctccggcgggagcgcctccagtagcattttccccacggtcggcgaaccgtcgaag
aagagttccgagtcggagaaaagtgacgaaacggtcatcaccgaaagcaagatggtcgtg
gtggttggaggcgcctccatggagttcgccgtgtcccgagccttgggcaaataccgccaa
cagaagcaaacctctctccccgacgatctctccttggaggaaccccaaggggtcgtgatc
gaggaaatcgtcgaagaggaaccaaaagtggacaagttggtcgaacaaatcagtactgaa
agcgaagtcagtcacacggaaccggtcctaagggcccaaaatcgctacttgcccaaacac
caacaaagtttggaaataccaggacataaggaggacgatgacagtcggagcacgcactcc
tggcggagcacctcccgagtgtcctcgcgccgccaaagcaccgaagacagcatcgacagt
gaggacgagtggtattgctacgagttgcggaagctggaggagatggaacgtcagtcgcag
cttgaagccgagatgggtgaaaccctccgggaggagcccgagttggaggaggagtacgaa
ccgttcgaggaggtcaaggagcggatgtccttcgtgttgcgagagctacgcatgaaggcc
aaggtcgtggagggggttctggaggagggcgacaacaacctccacaccctccaagaggcg
aagaaccgcgaacgcaaatccatccatttggaggaggcgcacatgttgttcgacaaaatc
gcccaaaacatcaaggaggaggaggaggagcaagccaaggacgaggaacactcctcgggg
gagacctccgggccggactccccccagcagagcgagaacgaggaggagaacacggaggag
tttgccaggtgtcacgtcaccccccgtgaggaggagcaagctgaggaggcttccgccgtc
cccgaaatccaggtcgaaccggaagtggcgaagcccgagaccaaggaaaccgccgggagt
aagtggaagctcttgaaggctttgaaggagcggaaggcggaggagaagagcaaccaggac
aaggttgagccagctagtgagaaggacaaaaacgggtctggacttggaggcgattccggc
ggacggacaaatggccatccaggagataatccattctacagtaacatcgacagtatgccg
gatatccggccacgacggaagtccataccgttggtttccgacttggtgctcaagacaatg
gcagcgacgaaacgaaacgctggtttgacgtcagcagttcctcgagcaactctcaacgat
gaagaactgaaaatgcacgtttacaagaaaaccctccaggcgctgatttaccccatcagc
agcaccaccccccataacttcgtcccgtggacggccacctcccccacctactgctacgag
tgcgaggggctgttgtggggcatcgctcggcagggggtgcgctgcaccgagtgctcggtg
aagtgccacgagaagtgcaaagacctcctcaacgccgattgcctgcaaagagccgctgag
aaaagttccaaacatggagctgaagataaagccaacagtattataacagcaatgaaggag
cgaatgaagcaaagggaacgagagaagcctgagatcttcgaacttatcagggccgtattc
ggcgtagaagacaagagtcacgccggtcatatgaaagccgtcaaacaatccgttctagat
ggtacctccaagtggtcagcaaagatagccatcacagtcaaatccgcacaaggactcatc
gccaaggacaagagcggcacctccgacccctacgtcaccgtccaggtcggcaaagtcaaa
aaacgcacaaggaccatgccccaggagctgaaccccgtctgggacgagaagttttatttc
gagtgccacaactcctccgaccggatcaaagtgcgcgtttgggacgaagacaacgacctt
aagagcaaactcagacagaagctgaccagggaatcggacgatttcctcggacagactatt
atagaagtgcggactttgtccggagagatggacgtttggtacaatttggagaaacgaacg
gacaagtccgccgtttccggcgcgattcgcttacacatatcggtggagatcaagggggag
gaaaaagtggccccatatcatgtacagtacacttgccttcacgagaacttgttccattat
ctgtgcgagcagaacagcggagttgtgagtctgccgcaggccaagggggacgatgcctgg
aaggtgtactttgaggaggctggggaggagattgtggacgagtttgcaatgcggtacggg
atcgagtcgatttatcaggcgatgacgcattttcactgcctctcgaccaagtatctgtgt
ccgggggtgccagctgtgatgagtatgctgctggcgaatattaatgcctattacgcacac
acgacggcttcgtcggccgtttcggcgagcgatcgattcgctgcctccaattttgggaaa
gagaaattcgtaaaactcctcgaccagctgcacaactccctccgcatcgacttatccatg
taccgcaacaacttcccggcttcgagccccgacaaactaatggacttgaaatccaccgtc
gacctcctcaccagcatcaccttcttccggatgaaggtccaggagttgacatgtccacca
cgtgccagcaccgtcgtcaaagactgcgtcaaagcctgtctccgctccacatatcaattc
ctcttcgaaaacacctacgagttgtacaatcgcgagttccaaagcgaccccaatgagccc
aagcgcgaccccgaagaccacggcccacgcctcgacagcgtcgacttctggcacaagctc
atcgcacttattgtgtccgttatcgaagaagataagaacagttatgggccggtgctgaac
cagttcccccaggagctgaatatcggacaactttcggcagccaccatgtggagtttgttt
gctgtggatatgaagtacgctctggaggagcatgaacagcatcgactgtgcaaaagctcg
gcttatatgaacttacatttcaaggtgaaatggctgtactcgaattatgtcaaagatgtg
cctccttataaaggtgcagtgcctgaatatcctgcatggttcgagcccttcgtcatgcag
tggttgaatgagaacgacgacgtttccctcgaataccttcacggtgccttcaatagagac
aaaaaggacggcttccaaagaagcagcgaacacgccctcttttccaattccgtcgtggac
gtcttcacccaactgacccaatgcttcgacgtcgtctccaaactggaatgtccagacccg
gagatctggaagcgctacatgaaacgcttcgccaaaaccatcgtcaaggtgctaatagcg
tacgctgacatcgtcaaaggggagttccccgaacacgtgaaagaggaacgaattgcttgc
attcttatgaacaatatccaacaattacgggtacaattggagaagatgttcgagtcaatg
gggggcgaaaagttggaagaagacgctgcgaacattctcaaggacttgcaacaaaccctg
aacgggtgtttggacgaattggccacgcagttcgcctccagccttgagccgcgcattacc
gtcagtgtgaaggaactaggcgacctccttttgagtattaaaggaggaggtcagcctgga
accacccaaccagcgcagagaaacgtcgtagcatcggaagctgacgaagtgttgcgacct
ctcatggacctccttgacggttcgctctccctctatgctcaatcgtgcgagaagactgtc
ctcaaacgcctcctcaaagagttgtggaagatcgtgatgaggatccttgagaaaacggtg
gtcttgccaccaatgacggacaaaacgatgatgttcaagagcctgactgacaatgcgaaa
aacctcgccgccaaaaccaaaatcgaggacatgtccacactgttcaaaaaccacatggcg
ggcaaacaggacgtgaagaacgccctcagcggcgttatggacatttcgaaggaggtggag
aagaacctctcccccaagcagtgtgcggtgctggacgtggccttggacaccatcaagcag
tacttccacgcgggcgggaacggcctgaagaaggccttcttggacaaaagcccagaattg
caaagtttgcgttacgccttatctctctatacgcaaacgactgacactcttatcaaaact
ttcgtcacgacgcaaattaacgaagacactttggatggccaagagggcagtgttggcgaa
gtgtcgattcaagtggatctattcacacatccaggcacaggcgagcacaaagttaccgtc
aaagttgttgccgccaatgatttgaaatggaacgtcgtttcgggaatgttccgaccgttc
gtggaagtgaatctgattggtccgcacctctccgacaagaagcggaaacacgcgacgaaa
tccaaggccaataactggtcgccgaagtataacgagacgtttcattttactattggtaac
gaggagcagttggactacttcgagttgcacatttgcgtcaaggactattgtttcgctcgc
gaggaccgacttgtgggcgtggccgtgatgcagctcaaggacatcgtggagaagggctcg
tgcgcctgctggctgtcattgggtaaacgcatccaaatggacgagactggttggacgatt
ctgcgcatcctctctcaacgcacaaatgatgaagtggcgaaggagtttgtcaaattgaaa
tcggatatacgtcaggaaaacccccttccgaaccagtaa

DBGET integrated database retrieval system