KEGG   Tribolium castaneum (red flour beetle): 658263Help
Entry
658263            CDS       T01046                                 

Definition
STAM-binding protein-like
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tca00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    658263
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     658263
Peptidases [BR:tca01002]
 Metallo Peptidases
  Family M67
   658263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG10
AA seq 391 aa AA seqDB search
MQSNVEPELKHTSGLINPQERLKHLINYSNAVEVDFHIPPTRYYRSGLEMVRMANVYNSE
GNYENAYVLYLKFMTLFLEKIRKHPDFNSVPVKMKAINQAKLREVLPKAEKLKERLLEQY
KEEFNRYVAERERRKELPKNSADTLATETNFASASTLVDPSSHSFVNVETPRNIDDITYP
DPDAAARRPRPVPSAPDFDRAKKPSEIFDSKYVPPGLRLVIVPGQVMVQFQTIAQKNTVN
NVETCGILAGKLENNQLIITHMILPKQKGTSDSCTTMNEEEIFDLQDQHNLITIGWIHTH
PTQTAFLSSVDLHTHCPYQLLMPEAVAIVCAPRYNETGFFILTPEYGLKFIANCRKSGFH
PHPTKPPLFMVAEHVKIDHSADLQVFDLRAQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcgaacgttgagcccgaactgaagcacacttcgggcctcataaatccgcaagaa
cgtctcaaacacctgattaattacagtaatgcggtcgaggtggacttccacattccccca
acaaggtactatcgctcaggccttgagatggtccgaatggccaatgtgtacaacagtgag
ggcaactacgagaacgcctacgttctctatttgaagtttatgactctatttctggaaaaa
atccggaaacatcccgattttaactcggttccggttaaaatgaaggccatcaaccaggcc
aagttgagggaggtgctccccaaagctgagaaactgaaagagaggcttctggagcagtac
aaggaggagtttaaccgatatgttgccgagagggaacggaggaaagaattgccgaaaaat
tcagctgatacgttggccactgagacaaatttcgcttcggcttccacgctggtggacccc
tcaagtcactcgtttgtcaacgtggaaaccccccgaaatattgatgacatcacgtatccg
gatccggacgccgcggcgcgccggcctaggcctgtgccgagcgcgcccgacttcgaccgc
gccaaaaaaccatcggaaattttcgattccaagtatgtgccccctggactgaggctagtt
atagtccctgggcaagtcatggtccagttccagaccattgcccagaaaaacacagtcaat
aacgtcgagacttgcggaattctcgccggaaaattggaaaacaatcaattaatcatcact
catatgatcctccctaagcaaaaagggacgtccgattcgtgcacgactatgaacgaggag
gaaattttcgacttgcaagaccagcacaatcttataacaattgggtggattcatacacat
ccgactcaaacggccttcttatcaagtgtggacttgcacacgcactgtccctatcagttg
ttgatgcccgaggctgtggctattgtttgcgccccgagatacaacgagactggatttttt
attttaactccggagtatgggttaaaattcatcgccaactgccggaaatccggttttcat
cctcaccctactaaaccacccctatttatggttgccgaacatgtgaagatcgatcacagt
gctgatttgcaagtgtttgatttgcgtgcgcaataa

DBGET integrated database retrieval system