KEGG   Tribolium castaneum (red flour beetle): 658263Help
Entry
658263            CDS       T01046                                 

Definition
amsh-like
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:tca04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG10
AA seq 391 aa AA seqDB search
MQSNVEPELKHTSGLINPQERLKHLINYSNAVEVDFHIPPTRYYRSGLEMVRMANVYNSE
GNYENAYVLYLKFMTLFLEKIRKHPDFNSVPVKMKAINQAKLREVLPKAEKLKERLLEQY
KEEFNRYVAERERRKELPKNSADTLATETNFASASTLVDPSSHSFVNVETPRNIDDITYP
DPDAAARRPRPVPSAPDFDRAKKPSEIFDSKYVPPGLRLVIVPGQVMVQFQTIAQKNTVN
NVETCGILAGKLENNQLIITHMILPKQKGTSDSCTTMNEEEIFDLQDQHNLITIGWIHTH
PTQTAFLSSVDLHTHCPYQLLMPEAVAIVCAPRYNETGFFILTPEYGLKFIANCRKSGFH
PHPTKPPLFMVAEHVKIDHSADLQVFDLRAQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcgaacgttgagcccgaactgaagcacacttcgggcctcataaatccgcaagaa
cgtctcaaacacctgattaattacagtaatgcggtcgaggtggacttccacattccccca
acaaggtactatcgctcaggccttgagatggtccgaatggccaatgtgtacaacagtgag
ggcaactacgagaacgcctacgttctctatttgaagtttatgactctatttctggaaaaa
atccggaaacatcccgattttaactcggttccggttaaaatgaaggccatcaaccaggcc
aagttgagggaggtgctccccaaagctgagaaactgaaagagaggcttctggagcagtac
aaggaggagtttaaccgatatgttgccgagagggaacggaggaaagaattgccgaaaaat
tcagctgatacgttggccactgagacaaatttcgcttcggcttccacgctggtggacccc
tcaagtcactcgtttgtcaacgtggaaaccccccgaaatattgatgacatcacgtatccg
gatccggacgccgcggcgcgccggcctaggcctgtgccgagcgcgcccgacttcgaccgc
gccaaaaaaccatcggaaattttcgattccaagtatgtgccccctggactgaggctagtt
atagtccctgggcaagtcatggtccagttccagaccattgcccagaaaaacacagtcaat
aacgtcgagacttgcggaattctcgccggaaaattggaaaacaatcaattaatcatcact
catatgatcctccctaagcaaaaagggacgtccgattcgtgcacgactatgaacgaggag
gaaattttcgacttgcaagaccagcacaatcttataacaattgggtggattcatacacat
ccgactcaaacggccttcttatcaagtgtggacttgcacacgcactgtccctatcagttg
ttgatgcccgaggctgtggctattgtttgcgccccgagatacaacgagactggatttttt
attttaactccggagtatgggttaaaattcatcgccaactgccggaaatccggttttcat
cctcaccctactaaaccacccctatttatggttgccgaacatgtgaagatcgatcacagt
gctgatttgcaagtgtttgatttgcgtgcgcaataa

DBGET integrated database retrieval system