KEGG   Tribolium castaneum (red flour beetle): 658295Help
Entry
658295            CDS       T01046                                 

Definition
similar to CG30426-PA
Orthology
K11421  
histone-lysine N-methyltransferase SETDB [EC:2.1.1.43]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:tca00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG8
AA seq 1153 aa AA seqDB search
MEEDDAMDIDETISSAQIIIRESTGVQIIGGPPSLDASQAGEAAPKAGPPKNPDVVVLDD
DEEEPIPPSKKTKTGEDSVEVIDLVQKSVNSKCINYACKSGKDLLVAPNLCLSYYRVKNS
GKGNKEVCSECYEVAIREYDMLASELEAGNILCNVEVPFRNDTVEIDDSDEEEEAAQVPP
LEDDSLRFFEENLEKVLSETMARLNVVSHAENEVNFLKAKNNKINGELSELQTMIKETRN
SLDSIQFNLYKECRPETVEKCIISIVDDHFTSTGPIVRTESVLPSITRKSQRTASKQVSY
TEVDSPSDSPKPDDVPAVGNPEPLVVRIDEMYYISRENSSGSWIKARLKRVLYPGTVYND
NPCTTTLYKMVELKQHVERVVDGKNIASMKHSTIRLETGTRVIAVFKEIGPTGEARKIRY
EPFYPGVVAEPPVAQNKYRYLIFFDIGYSQYVNYTNVHVVFEASKNVWEDMHVNSRPFIK
KYLESADRPMVKLSKGHTVRVEYNGKWVLCKIMEVDCSLVLVYFESLNRMEWIYRGSTRL
SPMFKEEQNATKRHTGGRTSNRKQGPSESATIVQYTKNSDFEKPAENSRTVRAVARKSTA
RPENTTSGGFVPFLPQVNNIPPVFSEPTSKIMYFTPRDQVITQRLYRPHTCSPACKDYVR
HSLGKLRGHNPLSKPLLCGWARMTLKVKGRKEIVYKAPCSQILRNMKEVHQYLRVTKSEM
TVDLFDFNHMVRCLAEFSVECNPDPKDLSKGLEQVPIPVINGINNEMLDFCNYATKRVPM
EDVPLNTDPEFLIGCDCTDDCSDKMKCACWQLTLEGAKYMGKNVDPNSIGYVYRRLHEQV
LTGIYECNSRCKCAATCLNRVVQNPMSIKLQVFRTHNRGWGIRCVNDVPQGTFICIYAGT
IHTEQMANEDGVTYGDEYFAELDYIENCEKHKEDYESDVNEPDSPRSRSATPEDEEEEQR
PDGRRRRWQRHPQDNDFTPSYPLVSGDFENSMRLRRRKEEEPKVEEKFFKKEEKIPLESV
TTEIETVTISDDEDDPKEVLSFNPKSGSDLDDNKPSQVSVRSFFGEEEPYIMDTKNAGNI
GRFLNHSCSPNVFVQNVFVDTHDLRFPWVAFFCSQFIRAGTELTWNYNYDIGSVPGRVLY
CHCGSLECKGRLL
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggacgacgctatggacattgacgagacaatttccagcgcccagataataatc
cgggaatcgaccggggtccaaataatcggggggccccccagcctcgacgcttcccaagcg
ggagaagccgccccaaaggcgggccccccgaagaaccccgacgtggtggtgctggacgac
gacgaggaagagcccatcccgccgtcgaaaaagacaaagacgggcgaagacagcgtcgag
gtgatagacctagtgcaaaaatccgtcaacagcaagtgcatcaattacgcctgcaagagc
ggcaaagacttgctcgtggcccccaacctgtgcctcagctactaccgggtgaaaaattcg
ggtaaggggaacaaggaagtgtgtagtgaatgctacgaggttgcaatacgggagtacgac
atgctggcatccgagctggaggcggggaatattctgtgcaatgttgaggtgccctttcgc
aacgacactgtcgagattgacgactcggacgaggaggaggaggcggcacaagtgccccct
ttggaggacgacagtttgcgcttttttgaggagaacctcgagaaggtgttaagcgagacc
atggctcggctgaatgtggtctcgcatgcggagaacgaggtgaatttcctcaaagcgaag
aacaacaagatcaatggcgagttgagtgagttacagaccatgatcaaagagacgagaaac
tcgcttgatagcattcagttcaacttgtacaaggagtgtcggcctgaaacggtcgaaaaa
tgcatcatttcgatcgttgacgaccacttcacctccacgggccccatcgtgcgcacagag
tcggtcctgccgtccatcacgcgcaagagccagcgcacggcctccaagcaggtgtcgtac
accgaggtggacagcccctccgacagccccaagcccgacgacgtgcccgccgtgggcaac
cccgagccgttggtggtgcgcatcgacgaaatgtactacatctcgcgcgagaactcgtcc
ggttcgtggatcaaagcgcgcctcaaacgcgtgctctaccccgggacggtctacaacgac
aacccctgcaccaccaccctgtacaaaatggtggagttgaagcagcacgtcgagcgcgtc
gtcgatgggaaaaacatcgcgtccatgaaacactccaccatcagactggagaccggcacg
cgcgttattgccgtcttcaaggagatagggcccacgggagaggcgagaaaaattaggtat
gagccgttctatcccggggttgtggcggagccgccggtggcgcaaaacaagtaccgatat
ttgattttcttcgatattggctattcgcagtatgtgaattacaccaatgtgcatgttgtt
ttcgaagcgagtaagaacgtgtgggaggatatgcatgtgaattcgaggccgtttattaaa
aagtacctggagagtgccgataggccgatggttaagctgtcgaaggggcacaccgttagg
gtggagtataatggaaagtgggttttgtgtaaaattatggaggtcgattgttcactcgtt
ttggtttatttcgaatcgttgaatcgtatggagtggatctacagaggatcgactaggttg
agtccgatgtttaaggaggagcaaaatgcgacgaaaagacacactggtggacggacgtcc
aataggaagcaagggccgagcgaatctgccaccatcgtgcaatacacgaagaactccgac
ttcgagaagccggccgaaaacagccgaaccgtccgtgccgtggctcggaaaagcaccgcc
cgccccgagaacaccacttccgggggcttcgtgccgttccttccccaagtcaacaacatc
ccccctgtcttcagtgaaccgaccagcaaaatcatgtacttcacaccacgtgaccaagtc
atcacgcagcgcctctaccgcccccacacctgctccccggcctgcaaagactacgtccgc
cacagtctgggcaagttgcgcggccacaaccccctgtcgaagccgctgctgtgcgggtgg
gcccgaatgactctgaaagtgaaagggcggaaagaaatcgtgtataaagctccgtgcagc
cagattttgcgcaacatgaaggaggtgcaccaatatttgcgcgtgactaagagcgaaatg
acggtcgatttgttcgatttcaaccacatggtgcggtgtttggccgaattcagcgtcgag
tgcaacccggacccgaaggatctgtccaagggcctggaacaggtcccgatcccggtcatc
aacgggatcaacaacgaaatgctcgatttttgcaattatgccacgaaacgtgtgcccatg
gaggatgttccgttgaacacggatccggagtttttgatcgggtgcgactgcacggacgat
tgttccgataaaatgaaatgcgcgtgttggcagctgacgctagagggcgccaagtatatg
gggaagaacgttgatccgaactcgatcggttatgtctatcgccggttacacgaacaggtt
ttaaccgggatttacgagtgcaattcgcggtgtaaatgcgcagcgacttgtctgaaccga
gtggttcagaacccgatgtcgattaaattgcaagtgtttcggacgcataacaggggctgg
gggatcaggtgtgtcaacgatgtgccgcaaggcacgtttatatgcatttatgcggggact
attcataccgaacaaatggccaatgaggatggggtcacctacggcgacgagtatttcgcc
gagttggactacatcgaaaactgcgaaaaacacaaggaagactacgagagcgatgtcaac
gaaccggacagcccccggagccgttcggcgactccggaggacgaagaagaggagcagagg
ccggacgggaggcggcgccgttggcagagacacccccaagacaacgatttcacccccagt
taccccctcgtgagtggcgacttcgagaattcaatgaggttgaggcgccggaaggaggag
gagccgaaagtcgaggagaaattcttcaaaaaagaagagaaaattccactcgagagtgtt
accactgagatcgaaaccgtcacgatttcagacgatgaggacgatccaaaggaagttttg
agttttaatccaaagtcggggtcagacctggacgataacaagccgagtcaagtgtcagtg
cgcagtttctttggggaggaggagccctacatcatggatacgaaaaatgcgggaaatatt
ggccggtttttaaatcactcgtgttcgcccaatgtcttcgtccagaacgtgttcgtggat
actcacgatctgaggttcccgtgggtcgccttcttctgttcgcagtttatcagggccggc
actgaactaacatggaactacaactacgacatagggagtgttccaggacgggtcttgtac
tgtcactgcggctcgttggagtgtaaaggaagattattgtag

DBGET integrated database retrieval system