KEGG   Tribolium castaneum (red flour beetle): 658299Help
Entry
658299            CDS       T01046                                 

Definition
(RefSeq) regulatory-associated protein of mTOR
  KO
K07204  regulatory associated protein of mTOR
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04136  Autophagy - other
tca04140  Autophagy - animal
tca04150  mTOR signaling pathway
tca04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:tca00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    658299
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    658299
   04136 Autophagy - other eukaryotes
    658299
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    658299
Membrane trafficking [BR:tca04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    658299
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Raptor_N HEAT HEAT_2 HEAT_EZ Cnd1 WD40 RTP1_C1
Motif
Other DBs
NCBI-GeneID: 658299
NCBI-ProteinID: XP_008196930
Position
LG8
AA seq 1099 aa AA seqDB search
MTELGVNGNDEKDSDKEAVSDKDLPLSFMQDRHLEPIEGVECITQTWRMKERMKTVSVAL
VLCLNVGVDPPDVMKTQPCARLECWIDPLTLSAPKSIQKIGENLQAQYERWQPRARYKQS
LDPTSEEVKKLCTSLRRNAKEERVLFHYNGHGVPKPTENGEIWVFNRTYTQYIPLSIYDL
QTWMGAPSIYVYDCSNAGIIIESFERFAAQHEAEYEQATSQSRQNPVVAPLPSYKSCIQL
AACGAKEVLPMNPDLPADLFTSCLTTPIKVALRWFVLQSTSKLVPKVTLDLIDKIPGQIT
DRRTMLGELNWIFTAITDTIAWNTLQRDLFQKLFRQDLLVASLFRNFLLAERILKSCDCT
PVSSPLLPPTSQHPMWNAWDLALDLSLGQLPGIINRNEPFQNLPFFEEQLTAFQVWLELG
CEERSPPEQLPIVLQVLLSQVHRMRALELLGRFLDLGPWAVNLALSVGIFPYVLKLLQSS
AKELRPLLVFIWAKILAVDNTCQGDLVRDSGHKYFLSVLQDTSLSSEYRTQSAFVLASIV
NNFHDGQEAALKGSLVSICLEQLNDPSSQLRQWVAICLGKLWDHYENARWTGVRDIAHEK
LYKLLNDPCPEVRAAAVYALGTFINSVTERSEHANNIDHAIVMTLVKKVSNDMSHLVRKE
LVNALQWVVLAFEHVFITLSMKEILSHYPLQEVNVTSPGLRRIGSRDRLRTSEDSVDKMK
RVSSSSSINNMGQMKGSLSHTGSLGTLPGLGYGSIYMKIWDALCSLETDPHPEVESMCKT
ITKYIANKVKESREFVDNKCASLPPSPNRGNYLSGESPPTLHPATDIPKYTPRGRKIHPN
IINEETDMKIKQRKALVSTKFIEWSCKRFAQSKRKSGFDVESPQFYERDWRYTRNNNIRR
EALDETSRILSSKLESQLFNTRTSLPPSVLQFHPFDQQIAVAGKDHFGIWDWGTGAKTTV
CHNKSAKAGSSRITSLEWINAHDVAMLMVASDDGSVKVWKPNTGHSREPTLISAWQALND
LKWKYSGTLLAWEQYTQTCIAAGDSRIVRFWDVEKELFAYDIMTGFLEFEHCYQERTARS
LASTRHFRAFRTKTTVKRT
NT seq 3300 nt NT seq  +upstreamnt  +downstreamnt
atgacagagttgggtgtcaacggcaatgacgagaaagacagtgacaaggaggctgtctcc
gacaaggacctgcccctgagcttcatgcaagacaggcacttggagcccatcgagggcgtc
gagtgcataacgcagacatggcgcatgaaagaacgcatgaaaacagtgagtgtggcccta
gttctgtgtctgaacgtgggcgtggacccgcccgacgtgatgaaaacccagccatgtgcg
cgtctggagtgctggatagatcccttaaccttgtccgccccaaagtcgatccagaaaatc
ggggagaacctgcaggcgcagtacgagcggtggcagccccgcgcgcgctacaagcagtcc
ctggaccccacttcggaagaagtcaaaaaactgtgcacttcgctgcgccgcaacgccaaa
gaggaacgcgttctgttccactacaacggtcatggagttcctaaaccgacggaaaacggt
gaaatctgggtgttcaatcgaacctacacgcaatacatccccctgtccatctacgacctg
caaacgtggatgggggcgccctcgatctacgtctacgactgctcgaacgccgggatcata
atcgagtctttcgagcggtttgccgcccaacacgaggccgagtacgagcaggccacgagt
cagtcgcggcaaaatccagtggtggcgcctttgccctcctataagagttgcatacagttg
gcggcgtgcggggcgaaggaagtgctaccgatgaatcctgatttaccggccgatttgttc
acgtcttgccttactacgccaatcaaggtcgccttaagatggttcgttctacagtctacc
tcaaaactagtgcccaaagtcaccctggatttgatcgataaaataccgggtcaaataacc
gaccgccgcacaatgctcggtgagcttaattggatctttacagcaattacagacaccata
gcctggaatacgttacagagagatctttttcaaaaactcttccgtcaagacctcctcgtt
gcgtcccttttccgtaatttcctcctcgctgaacgcatcctaaaatcgtgcgattgcact
cccgtcagttccccactgttaccaccaacctcccaacaccccatgtggaacgcatgggac
ctagccctcgacttgagcctcggccaacttcccggaatcatcaaccgaaacgaacctttc
caaaacttgcctttcttcgaagagcaattgaccgcgttccaagtttggctagaactcgga
tgcgaggagcgcagtccacccgaacaattgccaattgttttacaagtcctactcagtcaa
gtccatcggatgcgagcgcttgaactgttggggcggtttctcgatttgggaccgtgggct
gttaatttggccttgtctgttgggattttcccatacgttcttaaattattacagagtagt
gctaaggagttgaggcctttgttggttttcatctgggctaagattctagctgttgataat
acgtgtcaaggtgacttggtgagggacagtggccataaatatttcttgtcggtacttcag
gacacttcactttcgtcggaatatcggacacagtcggcttttgttttggcgtcaattgtt
aacaatttccacgacgggcaagaagcggccttgaaaggttccctagttagtatctgtctg
gaacaattgaacgaccccagttcacagttgagacaatgggtcgctatttgtttagggaaa
ttatgggatcattacgaaaacgcccgctggaccggtgttagagacatcgcccatgaaaaa
ctctacaaacttttgaacgacccatgcccagaggttcgggcagcggccgtttacgcctta
ggtacgtttataaattcggtgaccgagcgttcggaacacgccaataacatcgaccacgcg
atagttatgaccctagttaagaaagtcagtaatgacatgagccatctagtccgtaaagaa
ttagtaaatgcgctccaatgggtggtgttagctttcgaacacgtgtttataactttgtca
atgaaggagattctaagtcactatcccttgcaagaagtcaacgtgacttcgcccggcttg
cgacgaatcggcagccgggaccggttacgaacttccgaagacagtgtcgataaaatgaaa
cgggtgtcctccagctcctccataaacaacatggggcaaatgaaaggctccctcagccac
accggcagccttggcacgttaccaggcctcggctacggttcgatttacatgaaaatatgg
gacgctttgtgttcgcttgaaaccgacccgcaccccgaagtggaatcaatgtgtaagact
ataaccaagtacatagcaaacaaagtgaaggaatcgcgcgagttcgtcgataacaagtgt
gcaagtttgcccccgagccccaaccgggggaactacctgtcgggcgaaagccccccaact
ctccaccccgccaccgacatccccaaatacaccccaagggggcgcaaaatccaccccaac
atcatcaacgaagaaaccgacatgaaaatcaagcaacgcaaggctttagtgagtacgaag
ttcatcgaatggtcgtgcaaacgcttcgcgcaatcgaagcgaaagagtggctttgacgtc
gaatcgccccaattttacgaacgcgattggaggtacaccaggaataataatataagacgg
gaggctttggacgaaacttcgcgtatcctttcgtcaaaactcgaatctcagttgttcaac
actaggacctcgctcccgcccagtgtcctccagtttcacccctttgaccagcaaatcgca
gtggctgggaaggatcatttcgggatttgggattgggggactggggctaagacgacagtg
tgtcataataagtcggcaaaggctgggtctagtcggatcacttcgttggagtggatcaat
gcccatgatgtggcgatgttgatggtggcttcggacgatggtagtgttaaagtttggaag
ccgaatacgggtcacagtcgcgaaccgactctgataagtgcatggcaggctttgaatgat
ttgaagtggaaatattcagggacgctgttggcgtgggagcagtacacacagacgtgcatt
gcggcaggggattcgaggattgtccggttttgggacgtggagaaggagctgtttgcctat
gatattatgacaggttttttagaatttgaacattgttatcaggagcggactgcgcgatca
cttgcatcgactcgacattttcgggcgtttcgcacgaaaactacagtaaagcgtacctag

DBGET integrated database retrieval system