KEGG   Tribolium castaneum (red flour beetle): 658299Help
Entry
658299            CDS       T01046                                 

Definition
raptor-like
Orthology
K07204  
regulatory associated protein of mTOR
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    658299
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG8
AA seq 1264 aa AA seqDB search
MTELGVNGNDEKDSDKEAVSDKDLPLSFMQDRHLEPIEGVECITQTWRMKERMKTVSVAL
VLCLNVGVDPPDVMKTQPCARLECWIDPLTLSAPKSIQKIGENLQAQYERWQPRARYKQS
LDPTSEEVKKLCTSLRRNAKEERVLFHYNGHGVPKPTENGEIWVFNRTYTQYIPLSIYDL
QTWMGAPSIYVYDCSNAGIIIESFERFAAQHEAEYEQATSQSRQNPVVAPLPSYKSCIQL
AACGAKEVLPMNPDLPADLFTSCLTTPIKVALRWFVLQSTSKLVPKVTLDLIDKIPGQIT
DRRTMLGELNWIFTAITDTIAWNTLQRDLFQKLFRQDLLVASLFRNFLLAERILKSCDCT
PVSSPLLPPTSQHPMWNAWDLALDLSLGQLPGIINRNEPFQNLPFFEEQLTAFQVWLELG
CEERSPPEQLPIVLQVLLSQVHRMRALELLGRFLDLGPWAVNLALSVGIFPYVLKLLQSS
AKELRPLLVFIWAKILAVDNTCQGDLVRDSGHKYFLSVLQDTSLSSEYRTQSAFVLASIV
NNFHDGQEAALKGSLVSICLEQLNDPSSQLRQWVAICLGKLWDHYENARWTGVRDIAHEK
LYKLLNDPCPEVRAAAVYALGTFINSVTERSEHANNIDHAIVMTLVKKVSNDMSHLVRKE
LVNALQWVVLAFEHVFITLSMKEILSHYPLQEVNVTSPGLRRIGSRDRLRTSEDSVDKMK
RVSSSSSINNMGQMKGSLSHTGSLGTLPGLGYGSIYMKIWDALCSLETDPHPEVESMCKT
ITKYIANKVKESREFVDNKCASLPPSPNRGNYLSGESPPTLHPATDIPKYTPRGRKIHPN
IINEETDMKIKQRKALVSTKFIEWSCKRFAQSKRKSGFDVESPQFYERDWRYTRNNNIRR
EALDETSRILSSKLESQLFNTRTSLPPSVLQFHPFDQQIAVAGKDHFGIWDWGTGAKTTV
CHNKSAKAGSSRITSLEWINAHDVAMLMVASDDGSVKVWKPNTGHSREPTLISAWQALND
LKWKYSGTLLAWEQYTQTCIAAGDSRIVRFWDVEKELFAYDIMTGADCAITCIDSTFSGV
SHENYSKAYLDREKDDEGISIDEDFKWTRYGMVVAGFQDGSIRVFDRRCSPTEARIAVFM
EHSGPILGVHLLGNTFYSGSTDGHVRVFDVRNHRVVHTTQAIQNNMSCFALHRGTATYAC
GSLNQNVSIYGFNGCLLNTIKFYEGFMGHRTGNVTCLNYHPLKVALATGTSDCSVSVYCL
EGKR
NT seq 3795 nt NT seq  +upstreamnt  +downstreamnt
atgacagagttgggtgtcaacggcaatgacgagaaagacagtgacaaggaggctgtctcc
gacaaggacctgcccctgagcttcatgcaagacaggcacttggagcccatcgagggcgtc
gagtgcataacgcagacatggcgcatgaaagaacgcatgaaaacagtgagtgtggcccta
gttctgtgtctgaacgtgggcgtggacccgcccgacgtgatgaaaacccagccatgtgcg
cgtctggagtgctggatagatcccttaaccttgtccgccccaaagtcgatccagaaaatc
ggggagaacctgcaggcgcagtacgagcggtggcagccccgcgcgcgctacaagcagtcc
ctggaccccacttcggaagaagtcaaaaaactgtgcacttcgctgcgccgcaacgccaaa
gaggaacgcgttctgttccactacaacggtcatggagttcctaaaccgacggaaaacggt
gaaatctgggtgttcaatcgaacctacacgcaatacatccccctgtccatctacgacctg
caaacgtggatgggggcgccctcgatctacgtctacgactgctcgaacgccgggatcata
atcgagtctttcgagcggtttgccgcccaacacgaggccgagtacgagcaggccacgagt
cagtcgcggcaaaatccagtggtggcgcctttgccctcctataagagttgcatacagttg
gcggcgtgcggggcgaaggaagtgctaccgatgaatcctgatttaccggccgatttgttc
acgtcttgccttactacgccaatcaaggtcgccttaagatggttcgttctacagtctacc
tcaaaactagtgcccaaagtcaccctggatttgatcgataaaataccgggtcaaataacc
gaccgccgcacaatgctcggtgagcttaattggatctttacagcaattacagacaccata
gcctggaatacgttacagagagatctttttcaaaaactcttccgtcaagacctcctcgtt
gcgtcccttttccgtaatttcctcctcgctgaacgcatcctaaaatcgtgcgattgcact
cccgtcagttccccactgttaccaccaacctcccaacaccccatgtggaacgcatgggac
ctagccctcgacttgagcctcggccaacttcccggaatcatcaaccgaaacgaacctttc
caaaacttgcctttcttcgaagagcaattgaccgcgttccaagtttggctagaactcgga
tgcgaggagcgcagtccacccgaacaattgccaattgttttacaagtcctactcagtcaa
gtccatcggatgcgagcgcttgaactgttggggcggtttctcgatttgggaccgtgggct
gttaatttggccttgtctgttgggattttcccatacgttcttaaattattacagagtagt
gctaaggagttgaggcctttgttggttttcatctgggctaagattctagctgttgataat
acgtgtcaaggtgacttggtgagggacagtggccataaatatttcttgtcggtacttcag
gacacttcactttcgtcggaatatcggacacagtcggcttttgttttggcgtcaattgtt
aacaatttccacgacgggcaagaagcggccttgaaaggttccctagttagtatctgtctg
gaacaattgaacgaccccagttcacagttgagacaatgggtcgctatttgtttagggaaa
ttatgggatcattacgaaaacgcccgctggaccggtgttagagacatcgcccatgaaaaa
ctctacaaacttttgaacgacccatgcccagaggttcgggcagcggccgtttacgcctta
ggtacgtttataaattcggtgaccgagcgttcggaacacgccaataacatcgaccacgcg
atagttatgaccctagttaagaaagtcagtaatgacatgagccatctagtccgtaaagaa
ttagtaaatgcgctccaatgggtggtgttagctttcgaacacgtgtttataactttgtca
atgaaggagattctaagtcactatcccttgcaagaagtcaacgtgacttcgcccggcttg
cgacgaatcggcagccgggaccggttacgaacttccgaagacagtgtcgataaaatgaaa
cgggtgtcctccagctcctccataaacaacatggggcaaatgaaaggctccctcagccac
accggcagccttggcacgttaccaggcctcggctacggttcgatttacatgaaaatatgg
gacgctttgtgttcgcttgaaaccgacccgcaccccgaagtggaatcaatgtgtaagact
ataaccaagtacatagcaaacaaagtgaaggaatcgcgcgagttcgtcgataacaagtgt
gcaagtttgcccccgagccccaaccgggggaactacctgtcgggcgaaagccccccaact
ctccaccccgccaccgacatccccaaatacaccccaagggggcgcaaaatccaccccaac
atcatcaacgaagaaaccgacatgaaaatcaagcaacgcaaggctttagtgagtacgaag
ttcatcgaatggtcgtgcaaacgcttcgcgcaatcgaagcgaaagagtggctttgacgtc
gaatcgccccaattttacgaacgcgattggaggtacaccaggaataataatataagacgg
gaggctttggacgaaacttcgcgtatcctttcgtcaaaactcgaatctcagttgttcaac
actaggacctcgctcccgcccagtgtcctccagtttcacccctttgaccagcaaatcgca
gtggctgggaaggatcatttcgggatttgggattgggggactggggctaagacgacagtg
tgtcataataagtcggcaaaggctgggtctagtcggatcacttcgttggagtggatcaat
gcccatgatgtggcgatgttgatggtggcttcggacgatggtagtgttaaagtttggaag
ccgaatacgggtcacagtcgcgaaccgactctgataagtgcatggcaggctttgaatgat
ttgaagtggaaatattcagggacgctgttggcgtgggagcagtacacacagacgtgcatt
gcggcaggggattcgaggattgtccggttttgggacgtggagaaggagctgtttgcctat
gatattatgacaggagcggactgcgcgatcacttgcatcgactcgacattttcgggcgtt
tcgcacgaaaactacagtaaagcgtacctagaccgcgaaaaagacgacgaaggaattagc
atcgacgaggatttcaaatggactcgttacggcatggtggtggccggcttccaagacggt
tcaatccgagtgtttgaccgccgttgcagccccacagaggcccgaatcgccgtgtttatg
gaacattccggcccgattttaggcgtccacttactcggaaacacattttatagtggaagc
accgacggccacgtccgagtcttcgacgtgcgcaaccacagggttgtgcacacgacccaa
gccatccagaacaacatgtcctgctttgcgctgcatcgggggaccgccacctacgcctgc
gggtctctgaaccaaaatgtgagcatttacgggttcaacgggtgtctcctgaacacgatc
aagttctacgagggcttcatgggccaccgtaccggcaacgtcacgtgcctgaactaccat
ccgctgaaggtggcgctggccacaggcacgtccgactgctcggtgagcgtctactgtttg
gaaggtaaaaggtga

DBGET integrated database retrieval system