KEGG   Tribolium castaneum (red flour beetle): 658314Help
Entry
658314            CDS       T01046                                 

Definition
(RefSeq) cell division cycle protein 27 homolog
  KO
K03350  anaphase-promoting complex subunit 3
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    658314
Protein phosphatases and associated proteins [BR:tca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     658314
Ubiquitin system [BR:tca04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     658314
Chromosome and associated proteins [BR:tca03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    658314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 TPR_8 TPR_11 ANAPC3 TPR_16 TPR_12 TPR_17 TPR_19 TPR_6 TPR_14 TPR_9 SRP_TPR_like NARP1
Motif
Other DBs
NCBI-GeneID: 658314
NCBI-ProteinID: XP_969809
UniProt: D6WE80
Position
LG3
AA seq 820 aa AA seqDB search
MIVQEPVQAAIWHCLNHYDYTDAVFLSERLYAEVKSDDSLYLLATAYYRSGQKDHAYHIL
KERTDASTQCRYLLGICAYDLEKYAEAEAALLHSNKSSNDSENFDDITSEYGDQAPFALS
LLGNIAAKTERKPRAIDAWKRALKLNPFQWSSFENLCKIGDKPNPQNIFQITGVENLSMC
QGSNINNIESVVITNNNPNQDNQETYATTPQQILVNFSPNVVTSNSKLCTPDDNPIVTQN
VWLSGFAPFTSRTKLLRFRTDSSSNPSPQPSFGHFLDTSPDGYFSTPNLLSQPKLTESNN
HHQSLAKRVKAQVDQFINRKEPILQNCKPLFSQSTNVTKTPTISLAVQPCQNVRRSSRLF
TNSYSVKENNKSPNRTKFATPKSPSRKTKQRMAKCNLNKTTAYTELNTRNRIEKEKTETV
TSTDAKIEKSAISNSSSVESCVQQAILMQKQSAEGLMVLLRSLGQAYLHLSNFNCKAAIE
ELNVLPPNQFQTAWIYCLLGLAYFELTDYESSIKYFSKVHNLEPYRIQFMDVYSTALWHL
QKEVALSALAQDLISLNKNSPVTWCVSGNCFSLHKEHDTAIKFFQRAVQVDPRFPYAYTL
LGHEYITTEELDKAMSCFRNAIRLDPRHYNAWFGIGTIYSKQERYHLAEINYSRALEINP
QSSVILCHIGIVQHALKQTEKALKTFNVAIANNPKSPLCKFHRGSIYFALGRHAEALKEL
EELKEIVPKESLVYYLIGKVHKKLGNTDLALMHFSWATDLDPKGASSQIKEAFDPSIGRT
TSSESPTSPAAEEFLADRRPGLQPEALNFGNLPDDSEDSF
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgattgtacaggaaccagtgcaggctgccatttggcattgtttgaatcattatgactac
actgatgctgtattcttgtcagagcgattatatgctgaagtcaaatctgatgatagtctg
tacctcttggccacagcttattacagaagcggccaaaaagaccacgcataccacattttg
aaggaaaggacagatgcttcaacacagtgcagatatttgcttgggatttgtgcttatgat
cttgaaaaatatgctgaggccgaggcagctttgttacactccaataagagcagcaatgac
tccgagaatttcgacgacatcacatcagaatacggtgatcaagcaccattcgctttatct
ttattaggtaacatagctgccaaaaccgaaagaaaacctcgtgccatagatgcatggaaa
cgagccttaaaactaaatccatttcaatggtcaagcttcgaaaatttatgcaaaatagga
gataaaccaaacccccaaaatatattccaaataacaggtgttgaaaatttatcaatgtgc
cagggaagtaatattaacaatatcgaaagtgttgttataacaaacaacaatccaaatcaa
gataatcaagagacatacgccacaactcctcaacagattcttgtgaattttagccccaat
gtcgtaacttcgaattcgaaattgtgtacacctgatgataatccaattgttacacaaaat
gtgtggctgtcgggcttcgcccccttcacgtcgaggaccaagttgctgagatttcggacg
gattcctccagtaatccgagtcctcagccgagctttggccacttcttggacacctccccc
gacggttacttcagcacaccgaacctcctatcccaaccaaaactgaccgaatccaacaac
caccaccaatcgctagcaaagcgcgtgaaagcgcaagtcgatcaattcatcaatcgcaaa
gaaccgatcctccaaaactgcaaacccctattcagccaatcgacaaacgtcaccaaaacc
ccaacaatctcccttgccgtacagccatgtcaaaacgtcagacgcagctcacgcctcttc
accaacagctactcagtcaaagaaaacaacaaatcgcccaatcgaaccaaattcgccaca
cccaagtcgccctcgcggaaaaccaaacaacgaatggcgaaatgcaatttaaacaaaacc
acagcctacaccgaactcaacacacgcaaccgcatcgagaaggaaaaaaccgaaacggtg
acttcgaccgacgcaaaaatcgagaaaagtgcaataagtaatagtagtagtgtcgagagt
tgcgtccagcaggcgattctaatgcagaagcaaagtgccgaagggctgatggtcctcttg
cggagtttaggtcaggcgtacttgcatttgtcgaattttaattgcaaggcggcgattgaa
gaattgaacgttctgccgccgaatcagttccaaacggcttggatttattgtcttctgggg
ttagcctacttcgaattgaccgactacgagtccagcataaagtacttcagtaaagtgcac
aaccttgaaccgtaccggatacagttcatggacgtctactccacagcgttgtggcacttg
cagaaggaggtggcgttgtcagcgctggcccaggacctcatctctttgaacaaaaactcg
ccggtgacgtggtgcgtcagcggaaactgcttctcgttgcataaggagcacgacaccgcg
attaagtttttccaaagggctgtgcaagtcgatccgaggtttccctacgcgtatacgctg
ctagggcatgagtacatcacgacggaggagcttgacaaggcgatgagttgcttccgcaat
gccataagactggacccaagacattacaatgcctggtttggtatcggaaccatttactca
aaacaggagaggtaccatctggcggaaataaactactcgcgagcgcttgagatcaacccc
cagagctcggtgattctttgccacattggtatcgtccaacacgcgttgaagcagacggag
aaggctctgaagacgtttaacgtggccattgcgaataatccgaagagtccgctgtgtaag
ttccaccgggggtcgatttatttcgccctcgggaggcacgcagaggccttaaaggagctg
gaggagttgaaggagatcgttcccaaagagtcgctagtttactatttaataggcaaagtt
cacaagaagttaggaaacacggatttagcgctaatgcatttcagttgggcgacggatttg
gacccgaaaggggcgagtagtcagatcaaggaggcgtttgatccgtcgatcggtcgcact
acgtccagtgagtcgcccacttcgccagcggcggaggagtttctggcggataggaggccg
ggcttgcagccggaagcgttgaacttcgggaatcttccagacgatagcgaggatagtttc
taa

DBGET integrated database retrieval system