KEGG   Tribolium castaneum (red flour beetle): 658314Help
Entry
658314            CDS       T01046                                 

Definition
Cdc27 CG8610-PA-like
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Ubiquitin mediated proteolysis
Module
APC/C complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:tca04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG3
AA seq 820 aa AA seqDB search
MIVQEPVQAAIWHCLNHYDYTDAVFLSERLYAEVKSDDSLYLLATAYYRSGQKDHAYHIL
KERTDASTQCRYLLGICAYDLEKYAEAEAALLHSNKSSNDSENFDDITSEYGDQAPFALS
LLGNIAAKTERKPRAIDAWKRALKLNPFQWSSFENLCKIGDKPNPQNIFQITGVENLSMC
QGSNINNIESVVITNNNPNQDNQETYATTPQQILVNFSPNVVTSNSKLCTPDDNPIVTQN
VWLSGFAPFTSRTKLLRFRTDSSSNPSPQPSFGHFLDTSPDGYFSTPNLLSQPKLTESNN
HHQSLAKRVKAQVDQFINRKEPILQNCKPLFSQSTNVTKTPTISLAVQPCQNVRRSSRLF
TNSYSVKENNKSPNRTKFATPKSPSRKTKQRMAKCNLNKTTAYTELNTRNRIEKEKTETV
TSTDAKIEKSAISNSSSVESCVQQAILMQKQSAEGLMVLLRSLGQAYLHLSNFNCKAAIE
ELNVLPPNQFQTAWIYCLLGLAYFELTDYESSIKYFSKVHNLEPYRIQFMDVYSTALWHL
QKEVALSALAQDLISLNKNSPVTWCVSGNCFSLHKEHDTAIKFFQRAVQVDPRFPYAYTL
LGHEYITTEELDKAMSCFRNAIRLDPRHYNAWFGIGTIYSKQERYHLAEINYSRALEINP
QSSVILCHIGIVQHALKQTEKALKTFNVAIANNPKSPLCKFHRGSIYFALGRHAEALKEL
EELKEIVPKESLVYYLIGKVHKKLGNTDLALMHFSWATDLDPKGASSQIKEAFDPSIGRT
TSSESPTSPAAEEFLADRRPGLQPEALNFGNLPDDSEDSF
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgattgtacaggaaccagtgcaggctgccatttggcattgtttgaatcattatgactac
actgatgctgtattcttgtcagagcgattatatgctgaagtcaaatctgatgatagtctg
tacctcttggccacagcttattacagaagcggccaaaaagaccacgcataccacattttg
aaggaaaggacagatgcttcaacacagtgcagatatttgcttgggatttgtgcttatgat
cttgaaaaatatgctgaggccgaggcagctttgttacactccaataagagcagcaatgac
tccgagaatttcgacgacatcacatcagaatacggtgatcaagcaccattcgctttatct
ttattaggtaacatagctgccaaaaccgaaagaaaacctcgtgccatagatgcatggaaa
cgagccttaaaactaaatccatttcaatggtcaagcttcgaaaatttatgcaaaatagga
gataaaccaaacccccaaaatatattccaaataacaggtgttgaaaatttatcaatgtgc
cagggaagtaatattaacaatatcgaaagtgttgttataacaaacaacaatccaaatcaa
gataatcaagagacatacgccacaactcctcaacagattcttgtgaattttagccccaat
gtcgtaacttcgaattcgaaattgtgtacacctgatgataatccaattgttacacaaaat
gtgtggctgtcgggcttcgcccccttcacgtcgaggaccaagttgctgagatttcggacg
gattcctccagtaatccgagtcctcagccgagctttggccacttcttggacacctccccc
gacggttacttcagcacaccgaacctcctatcccaaccaaaactgaccgaatccaacaac
caccaccaatcgctagcaaagcgcgtgaaagcgcaagtcgatcaattcatcaatcgcaaa
gaaccgatcctccaaaactgcaaacccctattcagccaatcgacaaacgtcaccaaaacc
ccaacaatctcccttgccgtacagccatgtcaaaacgtcagacgcagctcacgcctcttc
accaacagctactcagtcaaagaaaacaacaaatcgcccaatcgaaccaaattcgccaca
cccaagtcgccctcgcggaaaaccaaacaacgaatggcgaaatgcaatttaaacaaaacc
acagcctacaccgaactcaacacacgcaaccgcatcgagaaggaaaaaaccgaaacggtg
acttcgaccgacgcaaaaatcgagaaaagtgcaataagtaatagtagtagtgtcgagagt
tgcgtccagcaggcgattctaatgcagaagcaaagtgccgaagggctgatggtcctcttg
cggagtttaggtcaggcgtacttgcatttgtcgaattttaattgcaaggcggcgattgaa
gaattgaacgttctgccgccgaatcagttccaaacggcttggatttattgtcttctgggg
ttagcctacttcgaattgaccgactacgagtccagcataaagtacttcagtaaagtgcac
aaccttgaaccgtaccggatacagttcatggacgtctactccacagcgttgtggcacttg
cagaaggaggtggcgttgtcagcgctggcccaggacctcatctctttgaacaaaaactcg
ccggtgacgtggtgcgtcagcggaaactgcttctcgttgcataaggagcacgacaccgcg
attaagtttttccaaagggctgtgcaagtcgatccgaggtttccctacgcgtatacgctg
ctagggcatgagtacatcacgacggaggagcttgacaaggcgatgagttgcttccgcaat
gccataagactggacccaagacattacaatgcctggtttggtatcggaaccatttactca
aaacaggagaggtaccatctggcggaaataaactactcgcgagcgcttgagatcaacccc
cagagctcggtgattctttgccacattggtatcgtccaacacgcgttgaagcagacggag
aaggctctgaagacgtttaacgtggccattgcgaataatccgaagagtccgctgtgtaag
ttccaccgggggtcgatttatttcgccctcgggaggcacgcagaggccttaaaggagctg
gaggagttgaaggagatcgttcccaaagagtcgctagtttactatttaataggcaaagtt
cacaagaagttaggaaacacggatttagcgctaatgcatttcagttgggcgacggatttg
gacccgaaaggggcgagtagtcagatcaaggaggcgtttgatccgtcgatcggtcgcact
acgtccagtgagtcgcccacttcgccagcggcggaggagtttctggcggataggaggccg
ggcttgcagccggaagcgttgaacttcgggaatcttccagacgatagcgaggatagtttc
taa

DBGET integrated database retrieval system