KEGG   Tribolium castaneum (red flour beetle): 658327Help
Entry
658327            CDS       T01046                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    658327
   01230 Biosynthesis of amino acids
    658327
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    658327
   00030 Pentose phosphate pathway
    658327
   00051 Fructose and mannose metabolism
    658327
   00052 Galactose metabolism
    658327
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     658327
Protein phosphatases and associated proteins [BR:tca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     658327
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG8
AA seq 785 aa AA seqDB search
MEGKAGHKFVGRGAHKGKGIAVFTSGGDSQGMNAAVRAVVRMGIYLGCKVYFIKEGYQGM
VDGGKYIVEANWSSVSSIIHKGGTVIGSARCQDFRERAGRLKAAKNLVENGITNLVVIGG
DGSLTGADLFRQEWSSLLEELATTGQITKEQQQKYRTLQIAGLVGSIDNDFCGTDMTIGT
DSALHRIIEACDAIVSTAYSHQRTFIMEVMGRHCGYLALISALATEADYAFIPENPADVN
WHEKLCHKLSQERHMGQRLNIIIVAEGAIDRNGDPITAEMIKKVVVDNLQQDTRITVLGH
VQRGGNPSAFDRILGCRMGAEAVMALMEADENTEPCVISLDGNQAIRLPLMDCVKRTKAV
SQAMADKKFDLAVELRGKSFMRNLETYKLLTRLKPPKDAFDEQGHGREGFTVAVMHIGAP
ACGMNAAVRSFVRNFIYRGDTVLGIQEGVEGLIAGNIKQMDWAEVAGWVGIGGANLGTKR
TLPGNRMGLVAARLAEFKIQGLLIIGGFEAFAAAVQFLDSRKDFPALNIPIVVIPGTISN
NVPGTEFSLGCDTALNEITEICDRIRQSAQGTKRRVFIIETMGGYCGYLATLAGLAGGAD
AAYIYEEKFTIKDLQQDVYHMATKMSEGVQRGLILRNEKASDNYNTDFIYRLYCEEGKGL
FSARMNVLGHMQQGGSPTPFDRNVGTKMASKAVEWMINQLKSNMSSDGSVSCSSQDSVVL
LGIVKRQYKFTPVAELKEQTNFDLRMPKEQWWLKLRPLLRILAKHDSTYEEEGMYMTIED
RSFIN
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaaaggccgggcataagtttgtggggcgcggagcccataagggcaaaggcatc
gctgtgtttaccagtggaggagattcacaggggatgaatgcggctgtcagggctgtggtc
aggatggggatttatttggggtgcaaagtctattttatcaaggaaggctaccaaggcatg
gttgatggcggcaagtacatcgttgaggccaattggtcctccgtaagctctattattcac
aaaggaggcactgtgattggaagcgctcgttgccaagatttccgtgaacgcgctggacgt
ctcaaagctgcaaaaaacctcgtagaaaacggcattaccaaccttgtagtaattggaggt
gatggtagtttaacaggtgctgacctcttccgtcaagaatggagctctctattggaggaa
ttggccaccacaggtcaaatcacgaaagaacagcaacagaaataccgcacgttgcaaatt
gccggtcttgtgggttcgattgataacgatttttgcggtactgatatgaccattgggacg
gacagtgcccttcacagaattatcgaagcttgcgatgctatagtcagtacggcttattcg
catcaaaggacttttattatggaggttatgggccggcattgcggttatttagcattgatc
agcgcgttggcaactgaagcagattacgcttttataccggaaaatcctgctgacgtgaac
tggcacgaaaaactctgtcataagttgtctcaggaacgccacatgggccaacgtctcaat
attattatcgtggctgaaggcgctatcgaccggaatggagacccaatcactgcagaaatg
atcaaaaaagtcgtcgttgataatctccaacaggacaccagaatcactgttttggggcac
gtgcaacgtgggggcaacccgtctgcttttgataggattctgggctgtcgtatgggggct
gaggccgtgatggcgctaatggaggctgatgagaatacagagccgtgtgtgatttcctta
gacggcaatcaggcgataaggttgccgttaatggattgcgtgaagcggacaaaagccgtc
tcacaggcaatggctgataagaaatttgatttggcggtggaattacgaggaaagtcattt
atgcgcaatttggagacttataagttgttgactcgactcaagcctccaaaggatgcattt
gatgagcaaggacatggaagggaaggtttcacagtggccgtaatgcatattggagctcct
gcttgtggcatgaatgccgctgtacgttcttttgtacgaaattttatctacagaggagac
acagttttgggcattcaggaaggagttgaaggtcttatcgctggcaatataaaacaaatg
gactgggccgaagtggctggttgggttggcatcgggggtgcaaatctgggcaccaaacgc
acccttcctggcaatcgtatgggtttagtagccgcccgattggccgaatttaaaattcaa
ggtttactcattattggcggttttgaagcatttgcagccgctgtacaatttctagacagc
cgaaaagatttcccagctctcaatataccaatcgtggtaatccccggaactatcagtaac
aatgtaccagggacggaattttcactaggttgtgacacagccttgaacgaaatcacagaa
atttgtgatagaatcagacagtcggctcaaggcacgaaaaggagggtttttattattgaa
accatgggcgggtattgcggatatttggccacacttgcaggtctcgctgggggtgcggat
gctgcgtacatttacgaggaaaaattcacaattaaagacttgcaacaagatgtctaccac
atggctacgaaaatgtccgaaggggtacaacgtggtttaattttgcgtaatgaaaaggcg
tcagataactacaataccgactttatctacagattgtattgtgaggaaggaaaaggcttg
tttagtgccaggatgaacgttttaggtcacatgcaacaagggggttcccccacacctttt
gaccgcaacgttggtaccaaaatggcgtccaaagcggtcgaatggatgatcaaccaatta
aaaagcaatatgagttcagacggctcagtcagttgttctagtcaagacagcgtcgttctg
ttaggaatcgttaaaagacaatacaagtttacaccagtcgctgagttgaaagagcaaacc
aactttgacttgcgtatgcctaaagagcaatggtggttgaaactgcgccctctattgcgt
attttggcaaaacatgattcgacatatgaggaagaagggatgtatatgacgattgaggat
cgcagttttattaattaa

DBGET integrated database retrieval system