KEGG   Tribolium castaneum (red flour beetle): 658362Help
Entry
658362            CDS       T01046                                 

Definition
similar to CG11198-PA, isoform A
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:tca01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tca00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tca00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:tca00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG6
AA seq 2321 aa AA seqDB search
MTETDKTIENGVQWTLGDESREQEDIFPQNGDSFDNLPPAARSDGQGGLTPQEQKALIEK
RKRLKPSMSQGTVMLQNRLQEKDFTVATPEEFVKRFNGTKVINKVLIANNGIAAVKCMRS
VRRWSYEMFKNERAVRFVVMVTPEDLKANAEYIKMADHYVPVPGGTNNNNYANVELIVDI
ATRLQVQAVWAGWGHASENPKLPELLHKNGIAFIGPPDKAMWALGDKIASSIVAQTADIP
TLPWSGSDLKAQYTGKKIKISSDLFARGCVQTAEQGLAAAQKIGFPVMIKASEGGGGKGI
RKVENADDFPAAFRQVQTEIPGSPIFVMKLAKCARHLEVQLLADQYGNAISLFGRDCSIQ
RRHQKIIEEAPAVIAASDVFEDMEKAAVRLAKMVGYVSAGTVEYLYDTSGHYYFLELNPR
LQVEHPCTEMVSDVNLPAAQLQIAMGLPLHYIKDIRLLYGESPWGNSEIDFDQPRHKPQP
WGHVIAARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVAASGGLHEFADSQFGHCF
SWGENREQARENLVIALKELSIRGDFRTTVEYLITLLETKSFQENTIDTAWLDILISEKV
ESEKPNVMLGVICGSLHIADKTISTAFQEFQNSLERGQIQGSNTLTNVVDVELIHGGNKY
KVQATKSGPNTYFLMMNGTFKEIEVHRLTDGGILLSVDGSSFTTYMKEEVDRYRIVIGNQ
TVVFEKENDPTILRSPSAGKLISFLIDDGGHVDKGQAYAEIEVMKMVMTLTSSESGTIFY
VKRPGAVLEAGSTIASLELDDPSLVTKAMLYKGPFPELDVSQPIVSEKLNHIHNSYKAVL
ENTLAGYCLPDPYNAPRLREVIEKFMSSLRDPSLPLLELQQVMASISGRIPPAVEKKIRR
LMSLYERNITSVLAQFPSQQIASVIDSHAASMQKRAERDGFFLATESIVQLVQRYRNGIR
GRMKVAVQELLRQYYDVESQFQQGSYDKCVALLREKHKDDMQSVSNTIFSHSQVAKKNLL
VTMLIDHLWSNEPGLTDELAPALTELTSLNRSEHSRVALRARQVLIAAHQPAYELRHNQM
ESIFLSAVDMYGHEFHPENLQKLIVSETSIFDILHDFFYHANRAVCNAALEVYVRRAYTS
YDITCLQHLELSGEVPVVHFQFLLPPTHPNRLIKLDDFKDSEDGPKVVDTFQRTGCMAAF
QNFQEFEQYADEILDLIEDFANPATISAKDLIAVESGSESRNSTSINVSLSLEGQRGGEE
SCMHEPIHILHVGIKDKGDTDDSSMSKIFGGFCVRHKEELISRGIRRITFAALKHKQSPK
FFTFRSRDDFKEDKIYRHLEPACAFQLELNRMRNYNLEALPTSNQKMHLYLGKAKGIGGK
EVTDYRFFIRSIIRHSDLITKEASFEYLQNEGERVLLEAMDELEVAFSHPHSRRTDCNHI
FLNFIPTVIMDPAKIEEAVTSMVMRYGPRLWKLRVLQAELKMIIRLAPNAPTQTIRLCLA
NDSGYYLDINMYTEEVDPDTGIIKFRAYGKKQGPMHGLPISTPYLAKDYLQQKRFLAQSA
GTTYVYDYPDMFRQMVDLQWKQYMNQRISEHIQPPDKLMDFVELILDPETESRLIEQKRV
PGENNVGMVAWRLTLYTPEYPDGRDVIVIANDITHMIGSFGPREDKVFGLASEIARCMKI
PRIYLAANSGARIGLAEEVKNSYKIAWEDNNEPDKGFRYLYLTPEDYAKVSAQNSVRAVL
IEDEGESRYKLTDIIGKDDGLGVENLRYAGMIAGETSRAYDEIVTISMVSCRAIGIGSYL
VRLGQRVIQIENSHIILTGYSALNKLLGRQVYASNNQLGGIQIMYNNGVSHKVEQGDLDG
IATVLKWLSYVPRDKNSPLPVIKPIDPIEREVDFIPTKAPYDPRWMLEGRASPLDPKNWE
SGFFDRDSWSEIMKPWAQTVVAGRARLGGIPVGVIAVETRTVELNLPADPANLDSEAKTV
SQAGQVWFPDSAYKTAQSIADFSREDLPLFIFANWRGFSGGMKDMYEQIMKFGAYIVDGL
RQYRKPVIIYIPPNGELRGGAWAVVDPTINSRYMEMYADPESRGGVLEPEGIVEIKYRKK
DLLKTMHRIDPVLRELDEKIVKFNQTRPMGERTSIVDLEAKITERENFLMPMYHQVSVHF
ADLHDTPERMLEKGAINDIVPWRKSRSILYWRLRRLLLQDKVVTALLDAQPMLGVGQGEA
MLRRWFIEDKGSTEGYKWDNNETVVHWLEDQLRKPPSQSIINYNLHCVKKDAVINQINVA
LEDCPDVALDAVVQIIQKLSDNQKAEVIRTLSQLGSVENID
NT seq 6966 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaacggacaaaacaatcgaaaacggagtccagtggactttgggggacgaaagt
agggaacaggaggacattttcccccaaaatggagattccttcgataatttacccccagct
gcgcgctccgatggccaagggggcctcaccccccaggagcaaaaggcactcatcgaaaaa
cgcaaacggctcaagccgagcatgtcacaaggcactgtcatgttacaaaatcgcctccaa
gagaaggatttcaccgttgccacaccggaggagttcgtcaagcgtttcaatgggaccaaa
gtcatcaataaagttctgattgccaataatggaattgcggcggtcaaatgcatgcgttcg
gtgcgtcgttggtcgtacgaaatgttcaagaatgaacgtgcggtccgttttgtcgtaatg
gtcacacctgaggacctcaaagccaacgcagagtacatcaaaatggccgatcactacgtc
ccagtgcctggcggtacaaataacaacaactacgccaacgtggaactcatcgtcgatata
gcgacccgacttcaggtacaagccgtttgggctggttggggtcacgcttcggaaaacccg
aaactacccgaacttttacataaaaacggtattgctttcattggcccacccgataaggca
atgtgggcactgggcgacaaaatcgcctcgagtattgtcgcccaaaccgccgacatcccc
acccttccatggtcgggctccgacctcaaggcccaatacaccgggaagaaaatcaagata
tcgtccgatttgttcgcccgagggtgcgtccaaacggcggaacaaggcctggcagccgcc
caaaaaatcggattcccggtcatgatcaaggcgtcggaaggtggagggggcaaaggcatc
cggaaggttgaaaacgcggatgatttcccagccgcctttagacaagtacaaaccgaaatt
ccgggttctcctatctttgtaatgaaactggccaagtgtgcgcgccatcttgaagtccag
ttattggccgaccaatacggtaacgccatttcgctgttcgggcgtgactgttccattcaa
cgccgccaccagaagatcatcgaggaggcgccggcggtcatagccgcctcggacgtgttc
gaagacatggaaaaggcggctgtgcgtttggccaagatggtgggttacgtctcggccggg
acagtggagtatttgtacgatacgtccgggcattactacttcctggagctcaacccgagg
cttcaggtggagcacccgtgcaccgagatggtgtccgatgtgaatttaccagcagcccag
ttgcaaattgcaatgggattgcctttgcactacatcaaagacattcgtttgttgtatggg
gaatcaccatggggtaactccgagattgatttcgaccaacccagacataaaccacagccg
tgggggcacgtaatcgcggctcggatcacgtcggaaaaccccgatgaaggttttaaacca
agttcggggaccgttcaagaattgaatttccggtcgtcgaaaaacgtatgggggtatttc
tcggtggcggcatctggtggtttacacgagtttgccgattcgcaatttggtcattgcttc
tcgtggggcgagaatcgggaacaggcaagggaaaatctagtgattgcgttgaaggagttg
agcatcaggggtgattttcggacgacggtcgaatacctaatcacgttactcgaaactaag
agtttccaagagaatactattgacaccgcgtggttggacatcctcatcagtgagaaggtt
gagtcggagaaacccaacgtaatgttgggtgtgatttgtggttccttgcacattgccgat
aagaccataagtacggccttccaggagtttcaaaattcgttagaacgtgggcaaattcaa
ggatcgaacactttgaccaacgtcgtagacgtggaattgatacatggtggtaacaaatac
aaagtccaagcgaccaaaagtggacccaacacctatttccttatgatgaatggtactttc
aaggagatcgaagtgcaccggttgaccgatggcgggattctactatcagtggacggttcc
tccttcaccacctacatgaaggaggaagtcgaccggtaccgcatcgtaatcgggaaccaa
actgtcgttttcgagaaagaaaacgacccgacaatcctgcgctcaccctcagccggtaaa
ctcataagtttcctgattgacgacggcggtcatgttgacaagggccaagcctacgccgag
atcgaagtcatgaaaatggtaatgacgctcacgtcgagtgaaagtggcacgattttctac
gtcaagcgacctggtgctgtgttggaagccggctctacgatagcatcgctagaacttgac
gatccgtcacttgtgaccaaagctatgctctataaaggtccgtttccggaattggacgtt
tcccagcccatagtttcggaaaaactcaaccacatccataacagttacaaggctgtcctt
gagaacacattggcgggttattgcctccctgacccctataatgcgccccgactgcgcgaa
gtgatcgagaagtttatgtcaagtctgcgagacccgagtttgcccttgttggagttacaa
caagtcatggcgtcaatctcgggccgcattcctccagccgttgagaagaaaatccgccga
cttatgagtctctacgaacgcaatataacaagtgtcctggcacagtttccaagccagcaa
atcgccagtgttattgacagtcatgccgccagtatgcaaaaacgggccgaacgtgacggt
ttcttcctcgccactgagagtatagtccagttggtgcaacgttaccggaacggcattcgg
ggccgtatgaaggtggcggtgcaggaattgttacgtcaatactacgacgtcgagagtcaa
ttccagcaaggttcctacgataagtgtgtggcgttgttgcgcgaaaaacacaaggatgac
atgcagagtgtctccaatacgattttcagccactcacaagtggccaaaaaaaaccttcta
gtaacaatgttgattgaccatttatggtcaaacgaaccgggactgaccgatgaactggca
ccggctttaaccgaactgacctcgctcaatcgtagcgaacactcccgagtggcactacgt
gcgcgccaggtgctaatcgccgcacatcaacccgcctatgagctacgccacaaccaaatg
gagagcattttcctctcagccgttgatatgtacgggcatgagttccaccccgaaaactta
caaaagctaatcgtttcggaaacttcaatctttgatattttgcacgatttcttctaccat
gccaatagggcggtgtgtaacgcggcgctggaagtgtacgtccggagggcgtacaccagt
tacgatatcacctgtttgcaacatttggaactatcgggggaagtaccagttgtccatttt
cagtttctactaccaccgacgcacccaaaccgcttgattaagttagacgatttcaaggat
agtgaagatgggccgaaagtcgtggatacgttccaaagaacggggtgcatggccgcgttc
caaaacttccaagagtttgagcaatacgccgacgagatccttgatttgattgaggatttt
gcgaatccggcgaccatttccgccaaggatttgatcgcggttgagagcggttccgagagt
cggaacagtacttcgattaatgtgagtttgtcgctggagggacaacgaggaggcgaggag
agttgtatgcatgagcctatccatatcctccatgtggggatcaaggataagggcgatacg
gacgatagtagtatgagtaaaatctttgggggtttctgtgtgcgacacaaggaggagttg
atcagtcgcgggatcagacggattactttcgccgccttgaagcacaaacaaagtcccaag
tttttcacgtttaggtcacgcgatgacttcaaggaggacaagatttatcggcatttggag
ccggcttgtgccttccaattggaattgaaccgcatgaggaattacaatctggaagccctt
ccaacgtccaatcaaaagatgcatctgtatttgggcaaggctaaggggattggcggcaag
gaagtgaccgattataggtttttcatcaggagtatcataagacatagcgatttgataacg
aaggaggcgtcgtttgagtacctccaaaacgagggtgagagggtgctgcttgaggcaatg
gacgagctagaggtggcgttttcgcacccgcattcacgtcgcactgactgtaaccacatc
ttcttgaactttatcccgactgtgattatggatccggcgaagattgaggaggctgtgact
agtatggtgatgcgttacggaccaaggttatggaagttgagggtgttacaagccgagctt
aagatgatcatacgtttggcgcccaatgctccgactcaaacgattcgtttgtgtctggct
aatgatagtggttactacctggatatcaatatgtataccgaggaagtggatccggatacg
ggaattatcaagtttagggcgtatggtaagaagcaagggccgatgcatggtctccccatc
tcgactccatacctagccaaggattatttgcaacaaaaacgctttttggcgcagtcggct
gggacgacctatgtttacgattatcccgatatgtttagacagatggttgatttgcaatgg
aagcaatacatgaatcagaggatttcggaacatatacaaccgcccgataaacttatggat
ttcgtcgaattgattctcgatcccgaaaccgagagtcgattaattgaacaaaaacgcgtc
cctggcgaaaataacgtagggatggttgcgtggcgcctcactttatacactccggagtat
ccagatggccgtgatgttattgttatagctaatgatataacgcatatgattggctcgttt
gggccacgtgaggataaggtgtttggattggctagcgaaattgcgcgatgtatgaaaata
ccaagaatttatttggccgccaacagtggcgctcgcatcggcttggccgaagaagtgaaa
aattcgtataaaatcgcatgggaagacaacaacgaacccgacaaagggttccgttaccta
tacctgacaccggaggactatgccaaagtttcggcccagaattcggtcagagctgtcttg
atcgaagacgagggcgagtcgcgttacaaactaaccgacattataggcaaagatgacggt
ttaggtgtcgaaaacttgcgatacgctggaatgatcgccggcgaaacatcccgagcctat
gacgaaatcgtcacaatatcaatggtttcgtgtcgagcgatcggaatcggctcatatcta
gtccgactgggacaaagagtcatccaaatcgaaaactcccatattattttgaccggttac
agtgccttaaataaactcctcggccgtcaagtctacgcttcaaacaaccaactaggcggc
atccaaatcatgtacaacaacggtgtttcacacaaggtggaacagggcgaccttgacggt
attgcaacagtgttgaaatggctttcttacgtcccgagggacaaaaacagcccactgcca
gtcatcaaacccatcgatccgatcgaacgcgaggttgattttatcccaaccaaggcaccc
tacgacccgcgctggatgctggaaggtcgggcttcgcccctcgaccccaaaaactgggag
agtgggtttttcgatcgtgattcctggtcggaaattatgaaaccgtgggcgcaaacggtc
gtagcaggccgggcccgtttggggggaatccccgtcggggtgattgcggtcgagacgcga
accgttgaattgaatttaccggctgatccggccaacttagattcggaggcgaagacggtg
tcgcaggcggggcaagtgtggttccccgactcggcgtataagactgcccaatcgattgcc
gatttctcgcgtgaggacctcccactgttcattttcgccaattggcgagggtttagtggc
ggtatgaaggatatgtacgagcaaatcatgaagtttggggcgtatattgttgatgggttg
agacagtatcgcaagccggttatcatttatataccgcccaatggcgagttgagaggcggg
gcttgggcggtcgttgaccccacgattaattcgcgctatatggaaatgtacgccgatccg
gaatcaaggggcggggttttggaaccggaagggattgtcgaaattaagtaccggaaaaag
gatttattgaaaactatgcatcggattgatccggttttgagggagttggatgagaaaatt
gtcaagtttaatcagacgagaccgatgggtgaacgcacatcgattgtggatttggaggcg
aaaattaccgaaagagaaaatttcttaatgccgatgtatcatcaagtgtcggtacatttc
gccgatttgcacgatacacccgaacgaatgttggagaaaggggccattaatgatatagtg
ccttggaggaaatcgcgatcgattttgtattggaggttgaggaggttgttactccaggat
aaggtggtgacggcgttacttgacgcacaaccgatgctgggggtggggcaaggggaggcg
atgttgaggaggtggtttattgaagataagggttcgactgagggctacaaatgggacaat
aatgagactgtggtgcactggctggaggaccagctccggaagcccccgagtcagtcaata
atcaattacaacctccactgtgtgaaaaaagacgctgttatcaaccaaatcaacgtggcg
cttgaggactgtccggacgtggccctcgacgctgtggttcaaatcattcaaaaattatca
gataatcaaaaagccgaagtgataaggactttgtcgcagctaggttcggtcgaaaatata
gactaa

DBGET integrated database retrieval system