KEGG   Tribolium castaneum (red flour beetle): 658362Help
Entry
658362            CDS       T01046                                 

Definition
acetyl-CoA carboxylase
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    658362
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    658362
   00640 Propanoate metabolism
    658362
  Lipid metabolism
   00061 Fatty acid biosynthesis
    658362
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    658362
Enzymes [BR:tca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     658362
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     658362
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG6
AA seq 2373 aa AA seqDB search
MLAQFWDKLWNYCERTEKTSSDSDSSWQKIDLEEVENSKMTETDKTIENGVQWTLGDESR
EQEDIFPQNGDSFDNLPPAARSDGQGGLTPQEQKALIEKRKRLKPSMSQGTVMLQNRLQE
KDFTVATPEEFVKRFNGTKVINKVLIANNGIAAVKCMRSVRRWSYEMFKNERAVRFVVMV
TPEDLKANAEYIKMADHYVPVPGGTNNNNYANVELIVDIATRLQVQAVWAGWGHASENPK
LPELLHKNGIAFIGPPDKAMWALGDKIASSIVAQTADIPTLPWSGSDLKAQYTGKKIKIS
SDLFARGCVQTAEQGLAAAQKIGFPVMIKASEGGGGKGIRKVENADDFPAAFRQVQTEIP
GSPIFVMKLAKCARHLEVQLLADQYGNAISLFGRDCSIQRRHQKIIEEAPAVIAASDVFE
DMEKAAVRLAKMVGYVSAGTVEYLYDTSGHYYFLELNPRLQVEHPCTEMVSDVNLPAAQL
QIAMGLPLHYIKDIRLLYGESPWGNSEIDFDQPRHKPQPWGHVIAARITSENPDEGFKPS
SGTVQELNFRSSKNVWGYFSVAASGGLHEFADSQFGHCFSWGENREQARENLVIALKELS
IRGDFRTTVEYLITLLETKSFQENTIDTAWLDILISEKVESEKPNVMLGVICGSLHIADK
TISTAFQEFQNSLERGQIQGSNTLTNVVDVELIHGGNKYKVQATKSGPNTYFLMMNGTFK
EIEVHRLTDGGILLSVDGSSFTTYMKEEVDRYRIVIGNQTVVFEKENDPTILRSPSAGKL
ISFLIDDGGHVDKGQAYAEIEVMKMVMTLTSSESGTIFYVKRPGAVLEAGSTIASLELDD
PSLVTKAMLYKGPFPELDVSQPIVSEKLNHIHNSYKAVLENTLAGYCLPDPYNAPRLREV
IEKFMSSLRDPSLPLLELQQVMASISGRIPPAVEKKIRRLMSLYERNITSVLAQFPSQQI
ASVIDSHAASMQKRAERDGFFLATESIVQLVQRYRNGIRGRMKVAVQELLRQYYDVESQF
QQGSYDKCVALLREKHKDDMQSVSNTIFSHSQVAKKNLLVTMLIDHLWSNEPGLTDELAP
ALTELTSLNRSEHSRVALRARQVLIAAHQPAYELRHNQMESIFLSAVDMYGHEFHPENLQ
KLIVSETSIFDILHDFFYHANRAVCNAALEVYVRRAYTSYDITCLQHLELSGEVPVVHFQ
FLLPPTHPNRLIKLDDFKDSEDGPKVVDTFQRTGCMAAFQNFQEFEQYADEILDLIEDFA
NPATISAKDLIAVESGSESRNSTSINVSLSLEGQRGGEESCMHEPIHILHVGIKDKGDTD
DSSMSKIFGGFCVRHKEELISRGIRRITFAALKHKQSPKFFTFRSRDDFKEDKIYRHLEP
ACAFQLELNRMRNYNLEALPTSNQKMHLYLGKAKGIGGKEVTDYRFFIRSIIRHSDLITK
EASFEYLQNEGERVLLEAMDELEVAFSHPHSRRTDCNHIFLNFIPTVIMDPAKIEEAVTS
MVMRYGPRLWKLRVLQAELKMIIRLAPNAPTQTIRLCLANDSGYYLDINMYTEEVDPDTG
IIKFRAYGKKQGPMHGLPISTPYLAKDYLQQKRFLAQSAGTTYVYDYPDMFRQMVDLQWK
QYMNQRISEHIQPPDKLMDFVELILDPETESRLIEQKRVPGENNVGMVAWRLTLYTPEYP
DGRDVIVIANDITHMIGSFGPREDKVFGLASEIARCMKIPRIYLAANSGARIGLAEEVKN
SYKIAWEDNNEPDKGFRYLYLTPEDYAKVSAQNSVRAVLIEDEGESRYKLTDIIGKDDGL
GVENLRYAGMIAGETSRAYDEIVTISMVSCRAIGIGSYLVRLGQRVIQIENSHIILTGYS
ALNKLLGRQVYASNNQLGGIQIMYNNGVSHKVEQGDLDGIATVLKWLSYVPRDKNSPLPV
IKPIDPIEREVDFIPTKAPYDPRWMLEGRASPLDPKNWESGFFDRDSWSEIMKPWAQTVV
AGRARLGGIPVGVIAVETRTVELNLPADPANLDSEAKTVSQAGQVWFPDSAYKTAQSIAD
FSREDLPLFIFANWRGFSGGMKDMYEQIMKFGAYIVDGLRQYRKPVIIYIPPNGELRGGA
WAVVDPTINSRYMEMYADPESRGGVLEPEGIVEIKYRKKDLLKTMHRIDPVLRELDEKIV
KFNQTRPMGERTSSISQTIEQKKPQEVVDLEAKITERENFLMPMYHQVSVHFADLHDTPE
RMLEKGAINDIVPWRKSRSILYWRLRRLLLQDKVVTALLDAQPMLGVGQGEAMLRRWFIE
DKGSTEGYKWDNNETVVHWLEDQLRKPPSQSIINYNLHCVKKDAVINQINVALEDCPDVA
LDAVVQIIQKLSDNQKAEVIRTLSQLGSVENID
NT seq 7122 nt NT seq  +upstreamnt  +downstreamnt
atgttggctcagttttgggataagttgtggaattattgcgaaagaaccgaaaaaacgtcg
tcggactccgactcctcttggcaaaaaatcgaccttgaagaagtggaaaactcaaaaatg
accgaaacggacaaaacaatcgaaaacggagtccagtggactttgggggacgaaagtagg
gaacaggaggacattttcccccaaaatggagattccttcgataatttacccccagctgcg
cgctccgatggccaagggggcctcaccccccaggagcaaaaggcactcatcgaaaaacgc
aaacggctcaagccgagcatgtcacaaggcactgtcatgttacaaaatcgcctccaagag
aaggatttcaccgttgccacaccggaggagttcgtcaagcgtttcaatgggaccaaagtc
atcaataaagttctgattgccaataatggaattgcggcggtcaaatgcatgcgttcggtg
cgtcgttggtcgtacgaaatgttcaagaatgaacgtgcggtccgttttgtcgtaatggtc
acacctgaggacctcaaagccaacgcagagtacatcaaaatggccgatcactacgtccca
gtgcctggcggtacaaataacaacaactacgccaacgtggaactcatcgtcgatatagcg
acccgacttcaggtacaagccgtttgggctggttggggtcacgcttcggaaaacccgaaa
ctacccgaacttttacataaaaacggtattgctttcattggcccacccgataaggcaatg
tgggcactgggcgacaaaatcgcctcgagtattgtcgcccaaaccgccgacatccccacc
cttccatggtcgggctccgacctcaaggcccaatacaccgggaagaaaatcaagatatcg
tccgatttgttcgcccgagggtgcgtccaaacggcggaacaaggcctggcagccgcccaa
aaaatcggattcccggtcatgatcaaggcgtcggaaggtggagggggcaaaggcatccgg
aaggttgaaaacgcggatgatttcccagccgcctttagacaagtacaaaccgaaattccg
ggttctcctatctttgtaatgaaactggccaagtgtgcgcgccatcttgaagtccagtta
ttggccgaccaatacggtaacgccatttcgctgttcgggcgtgactgttccattcaacgc
cgccaccagaagatcatcgaggaggcgccggcggtcatagccgcctcggacgtgttcgaa
gacatggaaaaggcggctgtgcgtttggccaagatggtgggttacgtctcggccgggaca
gtggagtatttgtacgatacgtccgggcattactacttcctggagctcaacccgaggctt
caggtggagcacccgtgcaccgagatggtgtccgatgtgaatttaccagcagcccagttg
caaattgcaatgggattgcctttgcactacatcaaagacattcgtttgttgtatggggaa
tcaccatggggtaactccgagattgatttcgaccaacccagacataaaccacagccgtgg
gggcacgtaatcgcggctcggatcacgtcggaaaaccccgatgaaggttttaaaccaagt
tcggggaccgttcaagaattgaatttccggtcgtcgaaaaacgtatgggggtatttctcg
gtggcggcatctggtggtttacacgagtttgccgattcgcaatttggtcattgcttctcg
tggggcgagaatcgggaacaggcaagggaaaatctagtgattgcgttgaaggagttgagc
atcaggggtgattttcggacgacggtcgaatacctaatcacgttactcgaaactaagagt
ttccaagagaatactattgacaccgcgtggttggacatcctcatcagtgagaaggttgag
tcggagaaacccaacgtaatgttgggtgtgatttgtggttccttgcacattgccgataag
accataagtacggccttccaggagtttcaaaattcgttagaacgtgggcaaattcaagga
tcgaacactttgaccaacgtcgtagacgtggaattgatacatggtggtaacaaatacaaa
gtccaagcgaccaaaagtggacccaacacctatttccttatgatgaatggtactttcaag
gagatcgaagtgcaccggttgaccgatggcgggattctactatcagtggacggttcctcc
ttcaccacctacatgaaggaggaagtcgaccggtaccgcatcgtaatcgggaaccaaact
gtcgttttcgagaaagaaaacgacccgacaatcctgcgctcaccctcagccggtaaactc
ataagtttcctgattgacgacggcggtcatgttgacaagggccaagcctacgccgagatc
gaagtcatgaaaatggtaatgacgctcacgtcgagtgaaagtggcacgattttctacgtc
aagcgacctggtgctgtgttggaagccggctctacgatagcatcgctagaacttgacgat
ccgtcacttgtgaccaaagctatgctctataaaggtccgtttccggaattggacgtttcc
cagcccatagtttcggaaaaactcaaccacatccataacagttacaaggctgtccttgag
aacacattggcgggttattgcctccctgacccctataatgcgccccgactgcgcgaagtg
atcgagaagtttatgtcaagtctgcgagacccgagtttgcccttgttggagttacaacaa
gtcatggcgtcaatctcgggccgcattcctccagccgttgagaagaaaatccgccgactt
atgagtctctacgaacgcaatataacaagtgtcctggcacagtttccaagccagcaaatc
gccagtgttattgacagtcatgccgccagtatgcaaaaacgggccgaacgtgacggtttc
ttcctcgccactgagagtatagtccagttggtgcaacgttaccggaacggcattcggggc
cgtatgaaggtggcggtgcaggaattgttacgtcaatactacgacgtcgagagtcaattc
cagcaaggttcctacgataagtgtgtggcgttgttgcgcgaaaaacacaaggatgacatg
cagagtgtctccaatacgattttcagccactcacaagtggccaaaaaaaaccttctagta
acaatgttgattgaccatttatggtcaaacgaaccgggactgaccgatgaactggcaccg
gctttaaccgaactgacctcgctcaatcgtagcgaacactcccgagtggcactacgtgcg
cgccaggtgctaatcgccgcacatcaacccgcctatgagctacgccacaaccaaatggag
agcattttcctctcagccgttgatatgtacgggcatgagttccaccccgaaaacttacaa
aagctaatcgtttcggaaacttcaatctttgatattttgcacgatttcttctaccatgcc
aatagggcggtgtgtaacgcggcgctggaagtgtacgtccggagggcgtacaccagttac
gatatcacctgtttgcaacatttggaactatcgggggaagtaccagttgtccattttcag
tttctactaccaccgacgcacccaaaccgcttgattaagttagacgatttcaaggatagt
gaagatgggccgaaagtcgtggatacgttccaaagaacggggtgcatggccgcgttccaa
aacttccaagagtttgagcaatacgccgacgagatccttgatttgattgaggattttgcg
aatccggcgaccatttccgccaaggatttgatcgcggttgagagcggttccgagagtcgg
aacagtacttcgattaatgtgagtttgtcgctggagggacaacgaggaggcgaggagagt
tgtatgcatgagcctatccatatcctccatgtggggatcaaggataagggcgatacggac
gatagtagtatgagtaaaatctttgggggtttctgtgtgcgacacaaggaggagttgatc
agtcgcgggatcagacggattactttcgccgccttgaagcacaaacaaagtcccaagttt
ttcacgtttaggtcacgcgatgacttcaaggaggacaagatttatcggcatttggagccg
gcttgtgccttccaattggaattgaaccgcatgaggaattacaatctggaagcccttcca
acgtccaatcaaaagatgcatctgtatttgggcaaggctaaggggattggcggcaaggaa
gtgaccgattataggtttttcatcaggagtatcataagacatagcgatttgataacgaag
gaggcgtcgtttgagtacctccaaaacgagggtgagagggtgctgcttgaggcaatggac
gagctagaggtggcgttttcgcacccgcattcacgtcgcactgactgtaaccacatcttc
ttgaactttatcccgactgtgattatggatccggcgaagattgaggaggctgtgactagt
atggtgatgcgttacggaccaaggttatggaagttgagggtgttacaagccgagcttaag
atgatcatacgtttggcgcccaatgctccgactcaaacgattcgtttgtgtctggctaat
gatagtggttactacctggatatcaatatgtataccgaggaagtggatccggatacggga
attatcaagtttagggcgtatggtaagaagcaagggccgatgcatggtctccccatctcg
actccatacctagccaaggattatttgcaacaaaaacgctttttggcgcagtcggctggg
acgacctatgtttacgattatcccgatatgtttagacagatggttgatttgcaatggaag
caatacatgaatcagaggatttcggaacatatacaaccgcccgataaacttatggatttc
gtcgaattgattctcgatcccgaaaccgagagtcgattaattgaacaaaaacgcgtccct
ggcgaaaataacgtagggatggttgcgtggcgcctcactttatacactccggagtatcca
gatggccgtgatgttattgttatagctaatgatataacgcatatgattggctcgtttggg
ccacgtgaggataaggtgtttggattggctagcgaaattgcgcgatgtatgaaaatacca
agaatttatttggccgccaacagtggcgctcgcatcggcttggccgaagaagtgaaaaat
tcgtataaaatcgcatgggaagacaacaacgaacccgacaaagggttccgttacctatac
ctgacaccggaggactatgccaaagtttcggcccagaattcggtcagagctgtcttgatc
gaagacgagggcgagtcgcgttacaaactaaccgacattataggcaaagatgacggttta
ggtgtcgaaaacttgcgatacgctggaatgatcgccggcgaaacatcccgagcctatgac
gaaatcgtcacaatatcaatggtttcgtgtcgagcgatcggaatcggctcatatctagtc
cgactgggacaaagagtcatccaaatcgaaaactcccatattattttgaccggttacagt
gccttaaataaactcctcggccgtcaagtctacgcttcaaacaaccaactaggcggcatc
caaatcatgtacaacaacggtgtttcacacaaggtggaacagggcgaccttgacggtatt
gcaacagtgttgaaatggctttcttacgtcccgagggacaaaaacagcccactgccagtc
atcaaacccatcgatccgatcgaacgcgaggttgattttatcccaaccaaggcaccctac
gacccgcgctggatgctggaaggtcgggcttcgcccctcgaccccaaaaactgggagagt
gggtttttcgatcgtgattcctggtcggaaattatgaaaccgtgggcgcaaacggtcgta
gcaggccgggcccgtttggggggaatccccgtcggggtgattgcggtcgagacgcgaacc
gttgaattgaatttaccggctgatccggccaacttagattcggaggcgaagacggtgtcg
caggcggggcaagtgtggttccccgactcggcgtataagactgcccaatcgattgccgat
ttctcgcgtgaggacctcccactgttcattttcgccaattggcgagggtttagtggcggt
atgaaggatatgtacgagcaaatcatgaagtttggggcgtatattgttgatgggttgaga
cagtatcgcaagccggttatcatttatataccgcccaatggcgagttgagaggcggggct
tgggcggtcgttgaccccacgattaattcgcgctatatggaaatgtacgccgatccggaa
tcaaggggcggggttttggaaccggaagggattgtcgaaattaagtaccggaaaaaggat
ttattgaaaactatgcatcggattgatccggttttgagggagttggatgagaaaattgtc
aagtttaatcagacgagaccgatgggtgaacgcacatcgagtatttcgcaaactatcgag
cagaaaaagccacaagaagttgtggatttggaggcgaaaattaccgaaagagaaaatttc
ttaatgccgatgtatcatcaagtgtcggtacatttcgccgatttgcacgatacacccgaa
cgaatgttggagaaaggggccattaatgatatagtgccttggaggaaatcgcgatcgatt
ttgtattggaggttgaggaggttgttactccaggataaggtggtgacggcgttacttgac
gcacaaccgatgctgggggtggggcaaggggaggcgatgttgaggaggtggtttattgaa
gataagggttcgactgagggctacaaatgggacaataatgagactgtggtgcactggctg
gaggaccagctccggaagcccccgagtcagtcaataatcaattacaacctccactgtgtg
aaaaaagacgctgttatcaaccaaatcaacgtggcgcttgaggactgtccggacgtggcc
ctcgacgctgtggttcaaatcattcaaaaattatcagataatcaaaaagccgaagtgata
aggactttgtcgcagctaggttcggtcgaaaatatagactaa

DBGET integrated database retrieval system