KEGG   Tribolium castaneum (red flour beetle): 658435Help
Entry
658435            CDS       T01046                                 

Definition
aldehyde dehydrogenase-like
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    658435
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     658435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEETLEBASE: 
UniProt: 
Position
LG6
AA seq 915 aa AA seqDB search
MPPNQSTVTNTPSLRIAIIGQSPFAVDVLKRLRQHGHVIVGVFTIPDKGTREDPLAKIAH
ECDIPLFKVKAWRKSGTPLPEVLANYRSVNADLNVLPYCSQFIPMEVINYPRLKTICYHP
SLLPRHRGASSINWTLISGDKKAGFSIFWADDGLDTGPILLQEECDVYEDDTVDSLYNRF
LYPAGVTALARAVDLVADGTAPREPQSEKGATYDPMLNKPELCQIDWGKTGPELHDFIRG
MDSVPGASCRVKVNDKYHEVALFGSSVWKGGKPQGLDVGIEGGPNGTIHEDGLILTGSDG
TMVNVKRVKIEGRVKLASNLLQTGQQVTIELTEDEKSQIESMRGIWKSILNTEIEDETDF
FASGAGSMDVVRLVEEIKDLLKLEDYQNEDVFLNPVFTEFSLNAVLKKRGGETPKEINYK
GVEIEANGLKIKVPCQLFINGEFVDAENGKTLPTVNPTTEETICQVQCGSAKDVDRAVQA
AKKAFYEGEWSKISARDRGQLLFKLADLMHQHREELATIESIDSGAVYTLALKTHVGMSI
ETWRYFAGWADKIHGSTIPVSHARPNKNLSFTKREPIGVCGLITPWNYPLMMLSWKMAAC
LAAGNTVIIKPAQVCPLTALKFAELAVKAGIPPGVINVVPGTGSTTGQAIATHPEVRKLG
FTGSTGIGQVIMKSCAESNLKKVSLELGGKSPLVIFADCDLDKAVRLGMQSVFFNKGENC
IAAGRLFVEESIHDEFIRRVVTETKKITIGDPLNKSTAHGPQNHQAHLTKLLDYIKMGVK
EGAKLEYGGERLNRKGYFLQPTIFSHVEDHMYIAKEESFGPIMVISKFSNGDIDGVLKRA
NATEYGLASGVFTRDLSKALKFAEKVEAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGQD
ALNEYLKTKCVTIEY
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaatcaaagcacagtcaccaacacgccatccctgcgcattgcgatcataggg
cagagccctttcgccgtcgacgtcctgaaacggctacggcaacacgggcacgtcatcgtg
ggggtgttcacaatccctgacaagggcacccgggaagatcccttagctaaaatcgcccac
gagtgcgacatccccttattcaaggtcaaggcgtggcgtaaatcgggcacgcccctcccc
gaagtcctagccaattaccgcagcgtcaacgccgacttgaacgtcctcccctactgctcg
caattcatcccaatggaagtcataaactatccccgcctcaaaacgatatgctaccacccg
tcgctcctcccacgccaccgcggcgccagttccatcaactggacgctcatttccggcgat
aaaaaggcggggtttagcattttctgggcggacgatgggctggacaccggaccaatcctg
ctacaggaggagtgtgacgtttacgaggacgacaccgttgattcgctctataaccggttt
ttgtacccggccggagtgaccgcccttgctagggccgttgaccttgtagctgacggtacc
gcccccagggaaccccagagtgagaaaggcgccacctatgaccccatgttaaacaaaccg
gaactttgccaaatcgattgggggaaaaccgggccggagttgcacgattttatccgaggg
atggattcggtcccgggggcgtcatgtcgggtcaaagtcaatgataagtaccacgaagtt
gcactttttgggtcaagtgtttggaaaggggggaagccccaaggactggacgttgggatt
gaaggtggtcccaatggtaccatacacgaggatgggttaattttgacgggttctgatggt
accatggtcaatgtcaagcgggtcaaaattgagggacgggtcaagcttgcctcaaacttg
ctccaaaccggtcaacaagtcacaattgagttgacggaggatgagaaaagtcaaattgag
tcaatgaggggcatttggaagtcaatcctcaatacggaaattgaggatgagaccgatttt
ttcgcctcaggggccgggtcaatggacgtcgtccgattggttgaggaaattaaggattta
ctcaaacttgaggattatcaaaatgaggatgttttcctcaatccggttttcaccgaattt
tcgttgaacgccgttttgaaaaaaaggggcggggaaacccccaaagaaatcaactataag
ggcgttgaaatcgaagctaatggactcaaaatcaaagttccgtgccaacttttcatcaat
ggggagtttgttgacgcggaaaatggaaaaaccctaccaactgtcaacccaaccaccgaa
gaaaccatctgtcaggtccaatgtggctcagccaaggacgtggacagggccgtccaagcg
gccaaaaaggccttttacgagggagaatggagcaaaatcagcgcacgtgaccgcggccaa
ctccttttcaagttggcagacctgatgcaccaacaccgcgaagagttggccacgatcgag
tcaatcgactcgggggcggtttacaccctagccctgaagacgcacgtcgggatgagcatc
gaaacgtggcgatacttcgccggatgggcggacaaaatccacggatcgaccatcccagtt
tcgcacgcccgccccaataaaaacctctcctttacgaagagagaaccgattggagtctgc
ggcctgatcacgccctggaactacccacttatgatgctatcgtggaaaatggcagcgtgc
cttgcggccggtaatacagttatcatcaaaccggcacaagtgtgccctctaaccgcactt
aaattcgccgaattggcggtcaaggcggggattcccccgggtgtgatcaacgtcgtgccg
ggcacggggtcaacgaccggccaagcgatcgcgacgcatcccgaagtacgcaagttgggt
tttacgggaagtaccggaatcgggcaagtcattatgaagtcgtgcgcggaatcaaacttg
aagaaagtgtcgcttgaactgggggggaagtccccactggttattttcgccgactgcgat
ctggacaaggccgtccgattgggaatgcaaagtgtttttttcaacaagggcgagaattgc
atagctgccgggcgacttttcgtggaggaaagcatccacgacgagtttattcgacgcgtg
gtcaccgaaaccaaaaaaataacaattggggatcccctgaacaaatcaacagcgcacggc
ccacaaaatcaccaagcacacttgaccaaactactcgattatattaaaatgggggtcaaa
gagggggcgaaattggaatatggaggggagcggttaaaccgaaagggttacttcctccaa
ccgaccattttcagccacgtggaggaccacatgtacatcgccaaggaggaatcgtttggg
cccatcatggttattagtaaatttagcaatggggacattgacggtgttttaaaacgtgca
aacgcgactgaatatgggctcgcctccggggtttttacccgagatttgtccaaagcgctc
aaatttgcggaaaaagtcgaagccgggactgtttttgtcaacacttataataaaacggac
gtcgcggcgccgtttggggggttcaagcagtcgggatttggcaaagatttaggacaagac
gctctgaacgaatatttgaaaacgaaatgcgtcacaattgagtattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system