KEGG   Tribolium castaneum (red flour beetle): 658456Help
Entry
658456            CDS       T01046                                 

Definition
glutathione peroxidase
Organism
tca  Tribolium castaneum (red flour beetle)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEETLEBASE: 
Position
LG3
AA seq 186 aa AA seqDB search
MGGTVPKTPLDSGFGETVLSPNGQYQNSASIYEFTANDIKGEPVSLEKYKGHVCIIVNVA
SQCGYTKNNYAELVDLFNEYGESKGLRILAFPCNQFAGQEPGTNEEICQFVSSKNVKFDV
FEKINVNGNDAHPLWKYLKHKQGGTLGDFIKWNFTKFIIDKNGQPVERHGPSTNPKDLVK
SLEKYW
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgggtggaactgtgccaaaaacgccacttgattcgggctttggggaaactgttctttcg
ccgaatggtcagtatcagaattccgcctccatctacgaattcaccgccaacgatatcaaa
ggtgaacccgtatcgttggaaaagtacaaagggcatgtgtgcatcatcgtgaacgtcgcc
tcccagtgcggctacaccaagaacaactacgcggagctggtggacctcttcaacgagtac
ggcgagtccaagggcttgaggatcttggcgttcccgtgcaatcagttcgccggccaggag
ccgggcactaacgaggagatttgccagtttgtttcgagcaagaatgtcaagtttgatgtt
ttcgagaaaattaatgtcaatgggaatgacgcgcatccgttgtggaagtacttgaagcac
aagcaagggggaacgttgggcgatttcatcaagtggaatttcaccaagtttattattgac
aagaatgggcagccggttgagagacatggacccagcactaatcccaaagacttggtcaag
tcactagagaagtactggtga

DBGET integrated database retrieval system