KEGG   Tribolium castaneum (red flour beetle): 658456Help
Entry
658456            CDS       T01046                                 

Definition
(RefSeq) glutathione peroxidase
Organism
tca  Tribolium castaneum (red flour beetle)
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA SCO1-SenC Redoxin
Motif
Other DBs
NCBI-GeneID: 658456
NCBI-ProteinID: XP_008198961
BEETLEBASE: TC010362
UniProt: D6WGA1
Position
LG3
AA seq 199 aa AA seqDB search
MLVPGLQLFSVATTVLRVFSTVPPVITSKAAMSNPEKPQEAASIYEFTANDIKGEPVSLE
KYKGHVCIIVNVASQCGYTKNNYAELVDLFNEYGESKGLRILAFPCNQFAGQEPGTNEEI
CQFVSSKNVKFDVFEKINVNGNDAHPLWKYLKHKQGGTLGDFIKWNFTKFIIDKNGQPVE
RHGPSTNPKDLVKSLEKYW
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgttggttcccggcctccagttgtttagcgttgcgacgacagtgttgcgggtgttttcg
accgtaccccctgtgattacctcgaaagccgcgatgtcgaacccggagaagccccaggaa
gccgcctccatctacgaattcaccgccaacgatatcaaaggtgaacccgtatcgttggaa
aagtacaaagggcatgtgtgcatcatcgtgaacgtcgcctcccagtgcggctacaccaag
aacaactacgcggagctggtggacctcttcaacgagtacggcgagtccaagggcttgagg
atcttggcgttcccgtgcaatcagttcgccggccaggagccgggcactaacgaggagatt
tgccagtttgtttcgagcaagaatgtcaagtttgatgttttcgagaaaattaatgtcaat
gggaatgacgcgcatccgttgtggaagtacttgaagcacaagcaagggggaacgttgggc
gatttcatcaagtggaatttcaccaagtttattattgacaagaatgggcagccggttgag
agacatggacccagcactaatcccaaagacttggtcaagtcactagagaagtactggtga

DBGET integrated database retrieval system