KEGG   Tribolium castaneum (red flour beetle): 658614Help
Entry
658614            CDS       T01046                                 

Definition
ubiquitin carboxyl-terminal hydrolase 8-like
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tca00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    658614
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     658614
Peptidases [BR:tca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   658614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG1=X
AA seq 779 aa AA seqDB search
MEPYNKLYLAKNLDSLDLLAKKDCGDLKHVKINAIYNSLNTLYKQSQLDVLDQEKTYILL
ARYLDVYSFLWNTESDKKFLQLRFGSEYEKVLLHYEKTKKSLEERYALLANDSPATPQPE
ETQPQVAAKPSQVFDSEFISCQQLYSALQKNYKFLLVDARPVSDFDESRINHPDCINIPD
EIIAAGLSANVLGKLLPDATREKWEMRDKYDVIVLFDWNTSSDNFAVTKLNKLHLSLVKW
DLNRNYRERPVILKGGYLELLQTYPTLCINPQVYLYQKNNELDELLELDDITYPTETDNK
TYVMGAPGDSLSDDTSGDQAASGEREYVYTRRDILNQLQHERNELKKIAEQCDRETNIKH
IAELKQRDAEIQEEIVRLESLLGDYDKNMILDLGDESTEESSDTLKDIIDEERDRELQKA
RALKPKNQGPEGAKDASTEVPELDKPQINRSTKPSPRPCPMVEEVEITPGLVGLRNIRNT
CYLNTIIHCFRNVPDIRDLFCKGIYTKFCIRNPAAIIHETANLVRQLWSRPVRSIDPMEF
YTKIGELEPTYSLGHHEDCMEFLLFLLNHLCEDCRYDVSLPAVLTPRQKAWYNQFEGKNS
IFIDYFYHQIRITQHCRQCDQKTFKFEIESTFMLPVPEEDFTLDELMSDYMADFIITEYC
CSKCKKPVNNQKEIIYEPKIMVIVLKRYRQALVNGQVLLKKIESRAHFKKRDFRLGKSRY
ELNAFAMHSGNMNFGHYTAAALTSKGWYEFNDENVRAININDDSVKSKACVFFYSRSDD
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atggaaccttacaacaaattatatcttgccaaaaatttggattcattggatcttcttgcg
aagaaagactgcggtgatctcaaacatgttaaaattaatgcaatatataactccttgaac
acgctgtataagcaaagtcagctagacgtcctcgaccaagaaaagacctacatcttgctg
gcgagatacttggacgtttacagctttctgtggaacaccgagtccgataaaaagttcctc
cagttacgattcggctcggagtatgaaaaggtcttgctgcattacgagaagaccaagaag
agtctcgaggagcggtacgccttactggccaacgacagccccgcaacccctcaacctgaa
gagacccagccgcaggttgcggccaagcctagccaagttttcgacagtgaatttatatct
tgccaacaattatacagtgccttacagaagaactacaagttcttgcttgttgatgctcgt
ccagtgagcgatttcgacgagtcgcgcatcaaccaccccgattgcatcaacatccctgac
gaaataatcgcagctggtttgtcagctaacgttttggggaaactgttgccggacgccacc
cgcgagaagtgggagatgagggacaaatacgacgtgatcgttttgttcgactggaacacg
tcttctgataattttgctgtgacgaagttgaacaagttgcatttgtctctagtcaaatgg
gatttgaaccgcaactatcgggaacgtcccgtgattctgaaagggggctatctcgagctg
ctccaaacctaccccaccttgtgcataaacccgcaggtttatctgtaccagaagaacaat
gaattggacgaactgctcgagcttgacgacatcacgtaccccactgagactgacaataag
acatatgtcatgggggcccccggcgacagcttgagcgacgacacttccggcgatcaagct
gcgtcgggggaaagagaatacgtgtacacaagacgcgacatcctgaaccagctacaacat
gaacgaaatgagctgaaaaaaatcgcagagcagtgcgatagagagaccaatattaaacat
atcgcagaactgaaacaacgtgatgcggagattcaggaagagatcgtgcgtctggagagc
ttgctcggcgattatgataagaacatgatccttgatttgggtgatgagtcaaccgaggaa
agctctgatactctgaaggatattattgacgaagagcgggaccgggagctgcagaaagcc
cgagccttgaagcccaaaaatcaggggccagaaggcgccaaagacgccagtaccgaggtt
ccggaattggacaaaccccagatcaatcgctcgactaaaccatccccaaggccctgtccg
atggtcgaggaggtggaaattacgccaggcttggtgggcttgcgtaatatccgaaatacg
tgttatctgaacaccatcatccactgtttccgcaacgtacctgacatcagagatctgttc
tgcaaaggcatttacaccaaattttgtattcgcaatccggcggcaataatccacgagacc
gccaatttggtgcgccagttgtggtccagaccagtgagatcaatcgatccgatggagttt
tacaccaaaatcggggaattagagcccacttattcgctgggacatcacgaagactgcatg
gagtttttgctctttttgctaaaccacttgtgcgaggattgccgctatgatgtgtctctg
ccggcggttctgacgccgcggcagaaggcttggtacaaccagttcgaggggaagaactcg
attttcatcgactacttctaccaccaaattagaataacccagcactgccgacagtgcgac
caaaaaaccttcaaatttgagattgagagcacgttcatgctgccagtccctgaggaagac
ttcactctggacgaactgatgagcgattacatggcggacttcatcataacggagtattgt
tgctccaagtgcaagaagccggtgaacaaccagaaggagattatttacgaaccgaagatc
atggtgattgtcctcaaaaggtacagacaagctctcgttaacggccaagtgctgctcaaa
aaaatcgaatctcgggcccacttcaaaaaacgcgacttccggctgggcaagagccggtat
gaactgaacgcgtttgccatgcattcggggaacatgaattttggtcactacactgctgca
gctttgacttccaaggggtggtacgaattcaatgacgaaaacgttagggcaatcaacatc
aacgacgattccgtcaaatcgaaggcttgtgttttcttctattcgaggagtgatgactaa

DBGET integrated database retrieval system