KEGG   Tribolium castaneum (red flour beetle): 658654Help
Entry
658654            CDS       T01046                                 

Definition
sphingosine kinase a, b-like
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tca00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG3
AA seq 587 aa AA seqDB search
METKSEESAQNRVLLEETFYVLTKKNCVFRVRLTKAGLCLVKESENNIKEQVIPIQDIIG
CRCLRSKKQSKNCACQSIPRSANLKVVEENSGDLDDTDVSAYLYIYAYILVNNKGTSKKR
ERTIITLRFRSFDKYEDNNKEAQRWRTMIKRLIKGENVSTSHIADFSVSNKYKEDRRLLV
LCNPKSGPGKGRIIFQQKVVPILQEAEIPYDLHITKYANFAREFIRTCNIFQWSGIILVG
GDGIVFEAINGLFERWDWSDVVKTIPIGVIPGGSGNGLARSIAYHCSEPYLPSPTLPSAL
AAVRNNCAPMDLVRVETTSQIMFSFLSVGWGFLSDIDIESERLRMLGGQRFTVWSVARLI
GLRSYGGKLWYLPANVPLVPTRLEVNTGSALDLPAEVHLETQTGRQRLDSWYSAASRRSA
YFSATGSSYQSTADSGGGGDPFGGDPDKPRMYGPASKLPCLTQPLDKETWKCIEGRFVMV
HASYQTHLGEDCLFAPDAKLNDGTIWLLIVHGGTTRTQLLHFLLGLSTGAHTSMVGEGGP
IELIAVNAFRIEPDMNEQGYMTVDGEHVEYGPIQAEVFPSLARVMVP
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgaaaagcgaagaatcggcccaaaacagggtccttctggaggagaccttctac
gttttgacgaagaagaattgcgtgtttcgggtccgcttgacgaaagccggcctttgtcta
gtgaaagaaagcgagaacaacatcaaagagcaagtgattccaatccaagacatcataggc
tgcaggtgtctcaggagcaagaaacagtcgaaaaattgcgcctgtcagtcaattccgcgc
tctgccaacctcaaagtagtcgaggaaaattcgggggatttggacgacacggacgtgagc
gcctacctctacatttacgcttatattttagtcaataacaagggcacgagcaaaaagagg
gagcgcacaattatcacgctgagatttcggtcgtttgacaaatacgaagacaacaacaag
gaagcgcagaggtggaggacgatgatcaagaggctgatcaagggcgagaacgttagcacg
agtcacattgccgatttttccgtttcaaataagtacaaggaagacaggaggttgttggtg
ttgtgcaaccccaagagcgggcctgggaagggcaggatcatttttcaacaaaaagtcgtt
cctattctacaggaggcggaaattccttatgatttacatatcaccaaatatgctaatttt
gcaagagaatttatcaggacatgcaatattttccagtggagtggaattattctggtcggc
ggtgacggcatcgtcttcgaagcaataaacggtctcttcgagcgctgggactggtccgac
gtcgtcaaaaccattccaatcggtgtgattcccggcggctccggcaacggcctagcccgc
agcatcgcctaccactgctcggagccctacctcccttcaccaaccctaccctccgccctc
gccgccgttcgcaacaactgcgcccccatggacctcgtccgcgtcgaaacaacctcccaa
ataatgttctcgttcttatcagtggggtggggcttcctttccgacatcgacatcgaaagc
gagcgcctccgcatgctaggggggcaacggttcaccgtgtggtcggtcgcgagactcata
gggctgcgcagctacgggggcaaattatggtatttaccggcgaacgtgcctttggtgccc
accagactcgaagtgaacaccggaagtgcattagatctgcctgcggaggtgcatttggag
actcagacggggcgtcagcggttggattcgtggtacagtgcggcgtcgcgacgcagcgcc
tatttttcggcgacggggagcagttatcagtcgacggcggatagtggcggtgggggcgac
cccttcgggggcgatccggacaagccacggatgtatggccccgccagcaagctcccttgt
ctcacgcagccccttgataaagagacatggaagtgcatagaggggcggtttgttatggtg
cacgcctcctatcagacgcatttgggggaggattgccttttcgcccccgatgccaagctc
aacgacggcacgatttggttgctgatcgtgcatgggggcaccacgaggacgcagctgttg
cattttctgttggggctgagcacgggggcacatacgtcgatggtgggcgaagggggcccg
attgagctgatagcagtgaatgcgttccggatagagccggatatgaacgaacaggggtat
atgacggttgatggggaacatgttgagtatgggccgattcaagctgaggtttttccgagt
ttggcgagagttatggttccctga

DBGET integrated database retrieval system