KEGG   Tribolium castaneum (red flour beetle): 658683Help
Entry
658683            CDS       T01046                                 

Gene name
Rpa2
Definition
replication protein A2
Orthology
K10739  
replication factor A2
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    658683 (Rpa2)
   03420 Nucleotide excision repair
    658683 (Rpa2)
   03430 Mismatch repair
    658683 (Rpa2)
   03440 Homologous recombination
    658683 (Rpa2)
   03460 Fanconi anemia pathway
    658683 (Rpa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEETLEBASE: 
UniProt: 
Position
LG8
AA seq 254 aa AA seqDB search
MFSVDQFDISNNGGFVNDDNQGSTAKKKQQVRRMQSVVPLFISHILECTDEEFNLYGMPV
HFADVVGVLKDFEVQTTKATCTIEDHSASIKAIMWLETDNDTVTALPPVKENCYVRVFGS
VRTQDGEKMIMILKILPVDDLNIVTNHLLEIIQAKLYAERLADGRLPAANLSTTVATTST
SAAANNSSGLKPMQVKIINLLKPIKSRTGLSRSEIMQHFGAQAREAEVALDFLLDEGHVY
TTVDTDHYKATDAD
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtttagtgttgatcagtttgatatcagtaacaacggcggtttcgtaaatgatgataac
caagggtccactgccaagaaaaaacagcaagtgaggcgcatgcaaagtgttgtccctttg
ttcatttcgcatatccttgagtgcaccgatgaggagttcaatttgtacgggatgccggtc
catttcgctgatgtcgtgggggttttgaaagactttgaggtccagacgaccaaagccacg
tgcaccattgaggaccacagtgcctccattaaggccattatgtggctggagaccgataac
gacactgtgacggcccttccccccgtcaaggaaaattgctacgtgcgtgttttcggctca
gtgcgcacccaagacggtgaaaaaatgatcatgattctcaaaatccttccagttgatgat
ttaaacatcgtcacaaatcatctcttggagattattcaagctaaattatacgctgaaaga
ctggccgatgggaggctcccagctgctaatttatcgaccactgtggccacaacgtccacg
tcagctgctgcaaataattcgtcgggacttaagccgatgcaagtcaaaattatcaatttg
ttgaaacctatcaaaagtaggactgggttgagtaggagcgaaattatgcagcactttgga
gcacaagcaagggaggctgaagtcgctttggatttcttgctggatgaggggcatgtgtat
actactgttgacaccgatcattacaaggccacagatgcggattaa

DBGET integrated database retrieval system