KEGG   Tribolium castaneum (red flour beetle): 658695Help
Entry
658695            CDS       T01046                                 

Definition
acyl-CoA Delta(11) desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    658695
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    658695
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     658695
Lipid biosynthesis proteins [BR:tca01004]
 Desaturase
  First
   658695
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 328 aa AA seqDB search
MAPNSTVTTTLTASELSPRESKILPEVTYRTLWGNFKTPLIWPNIIGIISVHVITIIGFV
TFPYFQHKSTFAWCFVTGWAGGFGVTAGAHRLWTHKSYKAKLPLRILLIICYAIAGQNRL
REWVRDHRVHHKFSESDADPHNANRGFFFAHVGWLMMRKHPEVLRKGKSIDCSDLFEDSV
VVFFEKFFWPMKLFWCFIFPTMIPYFCWNETFYWCVMSCIARYVCGLNFTWLVNSAAHMF
GNKPYDRKIQPVENLMVSILAMGEGWHNYHHTFPWDYKAAELGNYKVNATTLLLDLFAKI
GWAYDLKSPSKQLIQQVIENHGDGTRRD
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcccccaacagcacagtaactaccacactcacagcatcagaattatcacctagagaa
tcaaaaatattacctgaagtgacctatcgtacactttggggtaatttcaaaacacccctc
atctggccaaacatcatcggaataatctcagtacatgttattacaatcataggattcgtc
acatttccgtattttcaacacaaaagcacttttgcgtggtgttttgtaacaggttgggct
ggaggttttggagtaacagcaggagcacacagactatggactcataaatcatacaaggca
aaacttccattacgaatattgttaataatttgttatgcgattgcaggccaaaacagattg
cgtgaatgggtcagagatcatagagtgcaccacaaatttagcgaatcagatgctgaccca
cataatgcaaatcgaggtttttttttcgcccatgttggatggctaatgatgcggaaacat
ccggaggttttaagaaaaggaaaatcaattgactgtagcgatctgtttgaagactcggtt
gttgtatttttcgaaaagttcttttggccaatgaaattattttggtgtttcatttttcca
acaatgattccgtacttttgttggaacgaaaccttctactggtgtgtgatgagttgcata
gcaagatacgtatgtggccttaatttcacatggttagttaatagtgcggcccatatgttt
ggaaacaaaccttacgatagaaaaatccaaccagttgaaaatttgatggtttctattttg
gcaatgggcgaaggttggcacaattatcatcatacattcccttgggattataaagcagct
gaattaggaaattacaaagttaacgctacgaccttacttttagatttatttgccaaaata
ggatgggcctatgatttaaaaagtccatcgaaacagcttatacagcaagttatagaaaat
catggggatggcacacgcagagattaa

DBGET integrated database retrieval system