KEGG   Tribolium castaneum (red flour beetle): 658700Help
Entry
658700            CDS       T01046                                 

Gene name
eIF-4E
Definition
eukaryotic initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    658700 (eIF-4E)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    658700 (eIF-4E)
Translation factors [BR:tca03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    658700 (eIF-4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEETLEBASE: 
Position
LG10
AA seq 225 aa AA seqDB search
MKSAQSVHKYETLKHHAENSDSGSGDDEVGPYISDLGAIEYPPGEHRLQHPYCLWFSKRP
SQVQGSQGYSQALRLVGQVGTVEQWWALYTHIVRLQDIPAHRDLHLFKKGIKPMWEDAAN
KKGGKWVIRLRKEQAGRAWENLCMAMLGEQFMAGNEICGVVVSTRYQEYLLSIWNRTAAD
QATTARIRDALKRLLNIPASATMEYKTHNDCLKASKNIPNNALKS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcggcccagagcgtccacaaatacgaaaccttgaaacaccacgcggaaaactcg
gacagtggcagtggtgacgacgaagtggggccctacatcagtgacttaggggctattgag
tatcctcccggtgaacatcgattacaacatccgtactgtttgtggttctcaaagaggccg
tcacaggtgcagggctcacaggggtatagccaggcgttgcgactggtaggacaggtgggc
accgtggagcaatggtgggccctttacacgcacattgtccgcctccaagacataccggcc
caccgcgacctgcatctcttcaaaaagggcatcaagcccatgtgggaggacgccgccaat
aaaaagggcggcaaatgggtgatccggctacggaaggagcaagcaggtcgcgcgtgggaa
aacctttgtatggcaatgctcggcgaacagtttatggccggaaacgagatctgcggggtg
gttgtctctaccaggtatcaggagtaccttttgagtatatggaacaggacagcagcggat
caagcaacgacagcaagaattagggatgcgctcaaaagactgcttaatattccggcgagt
gccaccatggagtacaaaacacacaacgactgtcttaaggcgtcgaaaaatataccgaat
aatgcactaaagagttga

DBGET integrated database retrieval system