KEGG   Tribolium castaneum (red flour beetle): 658700Help
Entry
658700            CDS       T01046                                 

Gene name
eIF-4E
Definition
(RefSeq) eukaryotic initiation factor 4E
  KO
K03259  translation initiation factor 4E
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03013  RNA transport
tca04150  mTOR signaling pathway
Module
tca_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    658700 (eIF-4E)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    658700 (eIF-4E)
Messenger RNA biogenesis [BR:tca03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     658700 (eIF-4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     658700 (eIF-4E)
Translation factors [BR:tca03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    658700 (eIF-4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 658700
NCBI-ProteinID: NP_001164154
BEETLEBASE: TC012945
Position
LG10
AA seq 225 aa AA seqDB search
MKSAQSVHKYETLKHHAENSDSGSGDDEVGPYISDLGAIEYPPGEHRLQHPYCLWFSKRP
SQVQGSQGYSQALRLVGQVGTVEQWWALYTHIVRLQDIPAHRDLHLFKKGIKPMWEDAAN
KKGGKWVIRLRKEQAGRAWENLCMAMLGEQFMAGNEICGVVVSTRYQEYLLSIWNRTAAD
QATTARIRDALKRLLNIPASATMEYKTHNDCLKASKNIPNNALKS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcggcccagagcgtccacaaatacgaaaccttgaaacaccacgcggaaaactcg
gacagtggcagtggtgacgacgaagtggggccctacatcagtgacttaggggctattgag
tatcctcccggtgaacatcgattacaacatccgtactgtttgtggttctcaaagaggccg
tcacaggtgcagggctcacaggggtatagccaggcgttgcgactggtaggacaggtgggc
accgtggagcaatggtgggccctttacacgcacattgtccgcctccaagacataccggcc
caccgcgacctgcatctcttcaaaaagggcatcaagcccatgtgggaggacgccgccaat
aaaaagggcggcaaatgggtgatccggctacggaaggagcaagcaggtcgcgcgtgggaa
aacctttgtatggcaatgctcggcgaacagtttatggccggaaacgagatctgcggggtg
gttgtctctaccaggtatcaggagtaccttttgagtatatggaacaggacagcagcggat
caagcaacgacagcaagaattagggatgcgctcaaaagactgcttaatattccggcgagt
gccaccatggagtacaaaacacacaacgactgtcttaaggcgtcgaaaaatataccgaat
aatgcactaaagagttga

DBGET integrated database retrieval system