KEGG   Tribolium castaneum (red flour beetle): 658827Help
Entry
658827            CDS       T01046                                 

Definition
AGAP005618-PA-like
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:tca00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG2
AA seq 184 aa AA seqDB search
MVRAWYMDTDPSDQRTEHQRNPPKFLTLDELYKVSGVEYFKLNINSYATDGVLDKIKKER
GYTYEDEMTCSKECLANYDQMLKKFFQEHLHTDEEIRFVLDGSGYFDVRDKNDEWIRIEV
VAGDMIIIPSGIYHRFTLDTKDYIKAKRFFVGEPVWLPHNRPADDMECRKEYLKRLQSGE
FKSG
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtgcttggtacatggatacggatccttcggaccaaagaacagaacaccagaga
aatcctccaaaatttttaaccctagacgaattgtacaaagtttcaggagtggaatatttc
aagctaaatattaattcatatgcgactgatggcgttttggacaaaatcaaaaaagaacga
ggttatacgtacgaggatgaaatgacatgttctaaagaatgtttagctaattacgaccaa
atgctgaaaaaattctttcaagaacacttgcacacagatgaagaaattcgatttgttttg
gatgggtctggatattttgatgttagggataagaatgatgagtggattaggattgaggtg
gttgcaggcgatatgattattattcctagtggtatttaccatcgtttcactttggataca
aaagattatatcaaagctaagaggttttttgttggagagccagtttggctgccacataat
cgacctgcagatgatatggaatgcaggaaggaatatttaaagagattacaaagtggtgaa
ttcaagtctggttaa

DBGET integrated database retrieval system