KEGG   Tribolium castaneum (red flour beetle): 658827Help
Entry
658827            CDS       T01046                                 

Definition
AGAP005618-PA-like
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    658827
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     658827
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     658827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG2
AA seq 184 aa AA seqDB search
MVRAWYMDTDPSDQRTEHQRNPPKFLTLDELYKVSGVEYFKLNINSYATDGVLDKIKKER
GYTYEDEMTCSKECLANYDQMLKKFFQEHLHTDEEIRFVLDGSGYFDVRDKNDEWIRIEV
VAGDMIIIPSGIYHRFTLDTKDYIKAKRFFVGEPVWLPHNRPADDMECRKEYLKRLQSGE
FKSG
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtgcttggtacatggatacggatccttcggaccaaagaacagaacaccagaga
aatcctccaaaatttttaaccctagacgaattgtacaaagtttcaggagtggaatatttc
aagctaaatattaattcatatgcgactgatggcgttttggacaaaatcaaaaaagaacga
ggttatacgtacgaggatgaaatgacatgttctaaagaatgtttagctaattacgaccaa
atgctgaaaaaattctttcaagaacacttgcacacagatgaagaaattcgatttgttttg
gatgggtctggatattttgatgttagggataagaatgatgagtggattaggattgaggtg
gttgcaggcgatatgattattattcctagtggtatttaccatcgtttcactttggataca
aaagattatatcaaagctaagaggttttttgttggagagccagtttggctgccacataat
cgacctgcagatgatatggaatgcaggaaggaatatttaaagagattacaaagtggtgaa
ttcaagtctggttaa

DBGET integrated database retrieval system