KEGG   Tribolium castaneum (red flour beetle): 658869Help
Entry
658869            CDS       T01046                                 

Definition
similar to AGAP001238-PA
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
tca  Tribolium castaneum (red flour beetle)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG5; LG1=X
AA seq 1406 aa AA seqDB search
MQRTIRVNENQLIMLSERAHYDHSQAGYLHKRSADSSKWQLRWFVLYQNLLFYYDSENCH
RPSGVLLLEGCYCERLITTGSASKTKDGSEKQYCFAISYRRENIRQYELRALNEMECKNW
IEAIRDASFNKLLLQKEELEQKHLHLLQIVESEKTAKWQYTQQCEELASEIKKLRAELFA
LKKEWKPIPTHQSTSSLTSNQGTSTSTVSGPFAHVEQDSAELRKIKKVQSFFRGWLCRRR
WKQIVEQYIKSPHAESMRKRNSLVFRMVEAEEEYMEQMEVLVSCFLRPFKMAASSKKPPC
SHEDVNSIFLNSETVLFLHQIFLKGLTSRLESWPTLVLGDLFSMLLPMLSIYQEYVRNHH
YSLQVLTECKQSPQFSAMLKRLESKPACHGRSLETFLTYPMHQVPRYIITLHELLAHTPH
DHVERKSLQNARQQLEDLSRQMHDEVSETENLRKNLAVERMVVEGCDILLDVNQVFVRQG
SLIQLPTEKHRSSRSKLNFKSEKECVRQCFLFSNHLIIATRTSSGKLHLVPDIGKIPLAD
ALLIEDPSDNPEDDGSANTCSLHNRDFKIIVDLKDGSQPGQVTVHLLASSMQEKAAWISD
ISQCLDNVQFNDMIRPTMSDNSSITLPQSLKNDPKLFKDEADIRFSRTMNSCKVPQIRYA
TPERLLQRLTDLRFLSIDFLNTFLLTYRVFTDGVTVLEALKKVFYSSDPEPQGSVISLEV
FSNKDENTLQLYDDRRRSSFSPRRTSGASSVSGYGSEMSERDRSHSYDSQGHRHWKATLQ
KYEEESHEQTHPRIIRQSPTAQHKDSVSPPVQKSISIRVEQSETPKEDKTHLAIPKVAAS
SSSETLTGTQTHPHHAKTNPGLDVTVLSAPCSPSNLSSVTLVGSSPSDTTEGETGTSPKK
PPSPKKEPSPTKEPPHQRPSIVERKVERGTSEDTEEDMTQFFNTMHRASCSSSRSASIST
TTTSAVLQSYYGSRRSMQEGEATSTARSSFQHDSPQKPSKAGVVITSFRQSKRRSSTSSA
AAAFAIATSGSSNPRDLSPSARGGGMMDQDEFAMERNRYKENVISTACTMRVLNVLRHWI
SKHAQDFENDHKLKNLTIEFLDDIIYSPNLLPAEHKAAAQLLRLLTKEESESSKVDIFQL
VSAPSTPSKESIETLSALEIAEQLTYIDHQIFISISSEEFLGQAWMTNDKTSRAPHILLM
TKRFNDVSCLVASEILRRPSLCARVAAIEKWAAVADISRCLHNFNGVLQICSAFTNSSVF
RLKKTWDKVSKTTRQTIEKLQNIVSSDGRFRSLRDALHRCDPPCIPYLGLYLTDLSFIEE
GTPNFTQDGLLNFSKMRMIAHVIREIRHFQQTPYKIELIPKVANYLLDSSLWMDDEELYN
TSLEIEPRTSRLSTSALGQLSLSSKS
NT seq 4221 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaactatccgagtgaacgagaatcagctgataatgttatcagaaagggctcac
tatgaccactctcaagccggctatttgcataagagatcagcggacagcagtaaatggcag
ctgaggtggttcgtgctttaccagaacttgctgttttactacgattcggaaaattgccat
cgacccagcggcgtcctcctgctggagggatgctactgcgagcgacttatcaccaccgga
agcgcctcaaagaccaaggatgggtccgagaagcagtactgtttcgctatatcgtacaga
agagaaaatattcgccagtacgagctaagagctttaaatgaaatggagtgtaaaaactgg
attgaagctatacgagatgcaagttttaacaagttgctgttgcaaaaggaagaactggaa
cagaaacatttgcatttgttacaaatcgtcgaatcggaaaaaacagcaaagtggcaatat
acacagcaatgcgaggagttggcttctgaaattaaaaagctgcgagctgagttgtttgct
ttgaaaaaagaatggaagcccattccaacgcaccaatcgacgagcagtttgacatcaaat
caagggacatctacatcgaccgtctccggtccatttgctcacgttgagcaagactcggcc
gaattaagaaaaattaagaaagttcaaagctttttccgcggatggctgtgtcgtcgacgt
tggaaacaaatcgtcgaacaatacatcaaaagccctcatgctgaaagtatgagaaaacgc
aacagtctcgtattccgcatggttgaagccgaagaagagtacatggagcagatggaagtg
ctcgtctcgtgttttttgcgcccgtttaaaatggccgcatcgtcgaaaaaaccgccatgt
tctcacgaagacgtcaactcgatttttctgaacagcgagacggtgctatttttacaccaa
attttcctcaaagggttaacatcaagacttgaaagctggcctaccttagttttaggggat
ttattttccatgctacttcctatgctaagcatctatcaagagtacgtcagaaaccaccac
tactcccttcaagtactcaccgagtgcaaacaatcaccgcagttttcggctatgcttaag
cgactcgaaagcaaacccgcctgccatggcagatccttagagactttcctcacatatcct
atgcatcaggttccgaggtacattatcaccctccacgagctgctagcccacaccccccac
gaccacgtcgaacgaaagagcctccagaacgcccgccaacagctggaggacctctccaga
caaatgcacgacgaagtgtcggaaaccgagaatttacgcaaaaacctggccgttgagaga
atggtcgtcgaaggctgcgacatccttctcgacgttaaccaagttttcgtccgtcaaggc
agtctaatccaactaccgaccgaaaaacacagaagctcgagaagcaaattaaacttcaaa
agcgaaaaggaatgcgtccgacaatgtttcttgttttcgaatcatctcatcatcgccaca
aggacttcgagcggaaaactccatttagtcccagacatcggcaaaatacccctagctgac
gcgctcctgatcgaggatccaagtgacaaccctgaagacgatggtagtgcaaacacctgc
agtttgcacaaccgcgacttcaaaatcatcgtcgacctgaaggacggatcgcagcctggc
caggtcacggtgcatctgttggcgtcgtccatgcaggagaaagccgcatggatttccgat
atcagccagtgcttggataatgtccaatttaacgatatgatacggccgacgatgtctgat
aacagctccatcactcttcctcaatcgctgaagaatgacccaaagttgtttaaagacgag
gcagatatccggttcagtagaacaatgaactcttgtaaagttcctcaaataagatacgca
acaccagaacgccttcttcaaagactaactgatttaagattcctctccatagacttctta
aatacattcctccttacatatcgcgtttttaccgacggcgtaactgtcctggaagcttta
aagaaagtgttctatagtagtgatcccgaaccgcaaggctctgttatttccctcgaagta
ttttcgaacaaagacgaaaataccttacaattatacgatgaccgaagacgtagtagtttt
tccccgcgtagaacaagcggtgctagctctgtctccggctacggctcagaaatgagcgaa
cgggacagatcccacagttacgactctcaaggccacaggcattggaaagcaactttgcaa
aaatacgaggaagagagccacgagcaaacccacccgagaatcattagacagagcccgacc
gcacaacacaaagactcagtttcgcccccagtccaaaagtccatctccatcagagtcgaa
cagtccgaaactccaaaagaagacaaaacccacctcgccatccccaaagtcgccgcgtcc
agcagcagcgaaactttaacaggtacccaaacacaccctcaccacgccaaaactaacccc
ggcttagatgtgacagtgctaagtgctccctgctcgcccagcaacctaagctcggtaaca
ctagtcggctcctccccgtccgacaccaccgagggcgaaaccggaacttcgcccaaaaaa
ccaccatcacccaagaaagaaccatcaccgaccaaagagcccccacaccagagaccctca
atcgtcgagcgcaaagtcgaacgcggcacttcggaggacaccgaagaagatatgacacag
ttttttaacaccatgcaccgggcatcgtgcagctcctcgcgatccgccagcatctccacc
accaccacgagcgcagtcctccagagctactacgggtcccggcggtcaatgcaagagggc
gaagccacgtcaaccgcccgctccagcttccagcacgactccccccagaagcccagcaag
gcaggggtggtcataacgtccttccgacagtcgaagcgaaggagcagcacctccagcgcg
gctgccgccttcgccatcgccacctccggctcgagcaacccccgggacctgtccccgagc
gcccgcgggggcggcatgatggaccaagacgagttcgccatggaacggaaccggtacaag
gagaacgtcatctcgaccgcttgcaccatgagggttttgaacgttttgagacactggatc
tcgaagcatgcgcaagacttcgaaaacgaccacaagttgaagaacttgacgattgagttc
ttggatgatattatctacagccccaacttgctcccggcggagcacaaggccgcagctcag
ctcttgcgattgctgacgaaggaggagtccgagagctcgaaagtcgacattttccagctg
gtttcggcgccttcgaccccgagcaaggagagcattgagacgctttcagcgcttgagatc
gcggagcagttgacgtacattgaccaccagatttttatctcgatttcgagcgaggagttc
ctgggacaggcttggatgacgaacgataagaccagccgcgctccgcatattctcctgatg
acgaagcgttttaacgacgtttcttgcttggtggcgtcggagatcctccgccggccctct
ctgtgtgccagggttgcggcgatagagaaatgggccgctgtggccgacatttcgcgctgt
ttgcacaattttaacggtgttttacagatctgttcggcgtttactaacagctccgtgttc
cgtttgaagaaaacttgggataaagtgtcgaaaacgacgcggcaaactatcgagaaattg
caaaatatagtgtcgtcagatgggcggttcaggtcgctgcgggacgctctccacagatgt
gacccgccgtgtatcccctacttggggctttatctaactgatttgtcttttatcgaagaa
ggaacaccaaattttacacaagatgggctcttgaacttttctaagatgagaatgattgct
catgttattcgggagattcgtcactttcagcaaaccccatataaaattgagttgatacct
aaagtcgccaactatttgttggattcgtcgttgtggatggatgatgaagaactttacaat
acctcgttggaaatcgagccgcgaacctcacgtctgagcacttcagctctggggcagttg
tctttatcgtcaaaatcttaa

DBGET integrated database retrieval system