KEGG   Tribolium castaneum (red flour beetle): 658917Help
Entry
658917            CDS       T01046                                 

Definition
similar to CG7470-PA
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    658917
  Amino acid metabolism
   00330 Arginine and proline metabolism
    658917
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     658917
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     658917
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG1=X; LG2
AA seq 816 aa AA seqDB search
MFSANLIKSGRFVAFNGVGFFKIPGQIAAKRPDALTPVRTAATTPGLWLPKLSQVVNEKR
AFQEKKQSTFTDRSQLKYARRLVVKLGSAVITREDEHGLALGRLASIVEQVAECQNEGRE
CIMVTSGAVAFGKQKLTQELLMSLSMRETLSPTDHTREDAGTLLEPRAAAAVGQSGLMSL
YDAMFAQYGVKIAQVLVTKPDFYNEETRRNLFSTLSELISLNIVPIINTNDAVSPPPQVD
EPIGGKGGKKGISIKDNDSLAAMLAAEVQSDLLILMSDVDGIYNKPPWEEGARFLHTFTS
DLRHTIEFGQKSKVGTGGMDSKVNAATWALDRGVSVVICNGMQEKAIKTILSGRKVGTFF
TDSSVGGSLPTEIVAENARAGGRELQNLTPDQRASCVHTLADLLVSKQSEILDANAKDLS
EATKSGLAKPLLSRLSLTPAKLRNLSVGLKQIADSSHQNVGRVLRRTKLADGLDLTQITV
PIGVLLVIFESRPDSLPQVAALAIASANGLLLKGGKEAAHSNKALMELVKEALGTVGATN
AISLVSTREEIGDLLSMEQHIDLIIPRGSSELVRSIQSQSQHIPVLGHAEGICHVYVDXX
XXXXXXXXXXXXXXXXDADLSKALKIIRDAKCDYPAACNAMETLLIHEDLMQGDFFSDIC
NMLKHEGVKINAGPVLNKLLTFGPPLAKTMKHEYGALECCIEVVKSMDEAVNHIHTYGSG
HTEVIVTENSESARNFQRRVDSACVFHNASSRFADGFRFGLGAEVGISTARIHARGPVGV
EGLLTTKWVLSGNGHAAADFAEGGSCTWLHESLPVN
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgtttagtgctaatttaattaaaagcggccgttttgtggctttcaacggagtcggtttc
tttaagattccgggacagattgcggccaaaagacccgacgctttaacacctgtcaggacc
gcagccacaacgcccggcctttggctgcccaagctctcacaggtcgtcaacgagaaacga
gcttttcaagagaaaaagcagtcgactttcaccgatcgaagccaactaaaatatgccaga
agactagtggtgaaattaggaagtgctgtgattactcgagaagatgaacacggactagct
ttgggacggctcgcttcaattgtagaacaggttgcagaatgccagaacgagggcagagag
tgcattatggtgacaagcggtgctgtggcctttggaaaacagaaattgacccaggaattg
ctcatgtctctgtcgatgagggaaaccctctcacctacggatcacacaagagaggatgct
ggcacccttctggagccgcgtgctgcagccgccgtgggccaatcaggccttatgtccctt
tacgacgccatgttcgcccaatacggcgtgaaaatcgcccaagtattagtaacaaaaccc
gacttttacaacgaagagacgcgtcgaaacctcttcagcaccctgtcggagctgatcagc
ttgaacatcgtgcccatcatcaacaccaacgatgccgtttcgccgcctccacaagtcgac
gaaccgatcggaggcaaaggcggcaaaaaggggatcagcatcaaggataacgacagtttg
gcggcgatgcttgccgccgaagtccagtcagatctcctcattttgatgtcggatgtggac
ggaatctacaacaagccgccatgggaggagggagccagattcctccacactttcacgtcg
gatctcagacatactattgaattcggacaaaagtcgaaggttggaaccggaggaatggac
tcgaaggtgaatgccgccacgtgggcgctggatcgaggcgtttcggtggttatctgcaac
gggatgcaggaaaaagccatcaagaccatcttgtcggggaggaaagttggcactttcttc
accgattctagcgtcggggggtccctgcccacggaaatcgtcgccgaaaatgcccgcgcc
ggcggaagggagctgcagaacttaacccccgatcagcgggcctcttgtgttcacactctg
gccgatctcctcgtctcgaagcaatcggaaatcctggacgccaacgcgaaagatttatcc
gaagcgacgaaatccggtttagcgaaaccgcttctttcccgtttgtcgctcacgcccgcc
aaactgcgcaacttatcggtgggtctgaaacagatcgctgattccagccaccagaatgtg
ggtcgcgtcctcaggaggaccaaactggccgatggtctagacctcacgcagatcaccgtt
cccattggagtcctgcttgtcatcttcgagtcgcgaccggactctttgccccaagtggcc
gccttggccatcgcgtccgccaatggattgttgctcaaaggtggaaaggaagcggcccac
agcaataaggccctcatggaactcgttaaggaagcgctcgggacggttggggccaccaat
gcaatttctctcgtctccactcgggaagaaatcggcgatttactgtcgatggagcaacac
atcgatctcatcatccctcgcggttcgagcgaattagttcgaagcattcaatcgcaaagt
caacatatcccagtgttgggccatgccgaaggcatatgtcatgtgtacgtcgacaannnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnaagacgctgatttg
agcaaggctttgaagattattagagacgcgaaatgcgattatccggcggcatgcaacgcg
atggaaactctcctcatccatgaagatctgatgcaaggagacttcttttccgacatttgc
aatatgttgaaacacgaaggagtcaaaatcaatgcaggccccgttctcaacaagctcctc
accttcggcccgcctcttgccaagacgatgaagcacgaatatggggctttggagtgctgc
attgaagtcgtcaaaagcatggacgaagcggtcaaccacatccacacctatggaagtgga
cacaccgaagtcatcgtcaccgaaaattccgagagtgctcgaaacttccaacggcgcgtt
gacagcgcctgtgtgttccacaacgccagttcgcgatttgctgacggtttccggttcggt
ttgggggctgaggttggcatcagcactgccaggatccacgctagaggtcccgtaggagtc
gagggacttcttaccactaaatgggtgctctcagggaatgggcatgccgctgctgatttc
gccgaagggggatcatgcacttggctccatgaaagtcttccagtcaattaa

DBGET integrated database retrieval system