KEGG   Tribolium castaneum (red flour beetle): 658964Help
Entry
658964            CDS       T01046                                 

Definition
histone acetyltransferase KAT7
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     658964
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG9
AA seq 788 aa AA seqDB search
MSNMTAPNNKKHASSTESSSGSSDSSSSSSSSSGSDSSSSSDSESSSSQESTKQQSGSEL
KKSATIQKNPRKSSDSLKTGTSKSSDPKPAPKPKTQAPKTGKQPAKTTIYSSEDDDKPKP
SAKRKSTAKPKSSATITPKAATKPLPKPAVKNVQNKGAKGKEPPKKVVGKNAKNDSANKK
KSIFSPENSSESDDAAKKSRPKPAPPKPRPKAAARTVEKPKPVEKKPEKPAPKSKAVVSS
ASSATSSTASSSSSDSESSAESSSTTRKMSDKKITKKTLVAAKDRNVSDSETESTKQVTR
KLTRSASTRKSKHVLGKSVYSDTDSDTESTKRSLSRSPVKRAPVTTKGKTKNNKRNDAKS
RAEEIIIIEERKCPLEGCNSVGHLSGKYEKHFTLEACPMYHNLTPAQCKEELLERKKREE
MRRKALEFHRKSPRPQPTQEQKQYLQKIRDIHLKFKSEPMEETKPQNLDKNREPDLSNFV
PDYDLKLFRDAQALASEKIEEDLKTQPNTKGTKCIEMGKFEMEVWYQSPYPEDYARLPKL
YICEYCLRYMKTRTVLQRHVVKCVWRHPPGEEVYRKDKISVWEVDGKRYKQYCQNLCLLA
KFFLDHKTLYYDVEPFLFYVMTIVDTEGCHTVGYFSKEKNSFLNYNVSCILTLPPYQRQG
YGRLLIEFSYLLTKVEGKIGSPEKPLSDLGLISYRSYWKDVLLAYLCSGPGTQLSVKDIS
QEMAIHSYDIVSTLQALGMMKYWKGKHIILKKQDVLDEYIERVKKRGSMVKEVDRSCLRW
TPPQPASL
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacatgactgcacccaacaacaagaagcacgccagctcaaccgagagctcctcc
ggctcaagcgactcttccagctccagctcttcgtcaagcggttccgactcgtcctcatcc
agcgatagcgaatcgtccagttcgcaagaatccaccaaacaacaatccggatccgaatta
aaaaagagcgcaacgatccagaaaaacccgcgcaaaagctcagacagcctcaaaaccggc
acttccaagtcatcagaccccaaaccggcccctaaacccaaaacccaagcccccaaaacc
gggaaacaaccggccaaaaccaccatctactcgtcggaagatgacgacaaacctaaacct
agcgcgaagcgcaaaagcacagcaaagcctaaaagcagcgccacgatcacgcctaaagcc
gccactaagccgctgcctaaaccggccgttaaaaacgtgcaaaataagggcgccaaaggg
aaggaaccaccgaagaaggtggtcgggaaaaacgcaaagaatgattccgccaacaagaaa
aaaagcattttctcgccggaaaatagctccgaatccgacgatgcggccaagaagagtcgg
ccgaagcccgcgccacctaaaccccggcccaaggctgcggccagaacggtcgagaagccc
aaacctgtggagaagaagcccgaaaaaccggcgcctaaatctaaggccgtggtcagttct
gcgagttcggctacgtcctcaaccgcctctagtagcagctctgatagtgagagtagcgcc
gaatcgtccagcactactcggaaaatgagcgataaaaaaattacgaaaaaaactttggtt
gctgccaaagatcgaaatgtgtctgattcggagacggaaagcacgaaacaagtcactcgg
aagttgactcgctccgctagcacccgaaaatccaagcatgttttgggcaaaagcgtctat
tccgacacggattcggacaccgaaagcacgaaaagatcgctgagtcggtcccccgtcaag
cgcgccccagtcaccacaaaaggcaaaaccaagaacaataaacgcaacgacgccaagtcg
cgagccgaggaaataataataatcgaggagcgcaaatgccccctggaaggctgcaacagt
gtgggccacctgagcggcaaatacgagaaacacttcactctggaagcctgccccatgtac
cacaacctgacgccggcccagtgcaaggaagagctgctggaacgcaaaaagcgcgaagaa
atgcggcggaaagccctggagttccaccggaaatcgccgcggccgcagccaacccaagag
cagaagcaatacttgcagaaaatccgcgacattcacttaaaattcaaatcagagccgatg
gaagagacaaaaccgcaaaatctcgacaaaaaccgcgagccggatttatcgaatttcgtg
cccgattacgatctgaagctgttcagggacgcacaggcgttggcgagcgagaagatcgag
gaggatttgaagacgcagccgaacaccaaagggacgaaatgcatcgaaatgggcaagttt
gagatggaggtctggtaccagagtccctatcctgaggattacgcgcgcttgccgaaactt
tatatctgcgagtactgcttgcggtacatgaaaacgaggactgttctgcagagacatgtc
gttaagtgtgtctggagacacccgcccggggaggaagtctaccgcaaagataaaataagt
gtgtgggaagtggacgggaaacggtataaacagtactgccagaatttgtgtctgttggcg
aagttttttctggatcataagacgctctattatgacgttgagccgttcttgttctatgtc
atgacgattgtggacacggagggctgtcacaccgtgggatatttcagcaaggaaaagaac
tccttcctgaattacaacgtatcctgtatcctgactttgccaccctatcagcggcaagga
tatggaaggcttcttatcgaattcagttacttgctgacgaaagtcgagggaaagatcggc
tcccccgagaagcccttgagcgacttgggattgatttcttatcgctcgtattggaaagac
gtcctgctggcgtacctgtgctctggaccgggcacgcagttatcagtgaaagatatcagc
caagagatggcgatacactcttatgacatcgtctcgacgctgcaagcgctcgggatgatg
aaatattggaagggaaagcacatcatcctcaagaagcaggacgttctggacgaatacatc
gagcgcgtcaagaagcggggctccatggtcaaggaagtggaccgctcctgtctcaggtgg
acgccgccccagcccgcatccctctga

DBGET integrated database retrieval system