KEGG   Tribolium castaneum (red flour beetle): 658964Help
Entry
658964            CDS       T01046                                 

Definition
similar to chameau CG5229-PA
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
tca  Tribolium castaneum (red flour beetle)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG9
AA seq 793 aa AA seqDB search
MTAPNNKKHASSTESSSGSSDSSSSSSSSSGSDSSSSSDSESSSSQESTKQQSGSELKKS
ATIQKNPRKSSDSLKTGTSKSSDPKPAPKPKTQAPKTGKQPAKTTIYSSEDDDKPKPSAK
RKSTAKPKSSATITPKAATKPLPKPAVKNVQNKGAKGKEPPKKVVGKNAKNDSANKKKSI
FSPENSSESDDAAKKSRPKPAPPKPRPKAAARTVEKPKPVEKKPEKPAPKSKAVVSSASS
ATSSTASSSSSDSESSAESSSTTRKMSDKKITKKTLVAAKDRNVSDSETESTKQVTRKLT
RSASTRKSKHVLGKSVYSDTDSDTESTKRSLSRSPVKRAPVTTKGKTKNNKRNDAKSRAE
EIIIIEERKCPLEGCNSVGHLSGKYEKHFTLEACPMYHNLTPAQCKEELLERKKREEMRR
KALEFHRKSPRPQPTQEQKQYLQKIRDIHLKFKSEPMEETKPQNLDKNREPDLSNFVPDY
DLKLFRDAQALASEKIEEDLKTQPNTKGTKCIEMGKFEMEVWYQSPYPEDYARLPKLYIC
EYCLRYMKTRTVLQRHVVKCVWRHPPGEEVYRKDKISVWEVDGKRYKQYCQNLCLLAKFF
LDHKTLYYDVEPFLFYVMTIVDTEGCHTVGYFSKHRKPFGLQEKNSFLNYNVSCILTLPP
YQRQGYGRLLIEFSYLLTKVEGKIGSPEKPLSDLGLISYRSYWKDVLLAYLCSGPGTQLS
VKDISQEMAIHSYDIVSTLQALGMMKYWKGKHIILKKQDVLDEYIERVKKRGSMVKEVDR
SCLRWTPPQPASL
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacccaacaacaagaagcacgccagctcaaccgagagctcctccggctcaagc
gactcttccagctccagctcttcgtcaagcggttccgactcgtcctcatccagcgatagc
gaatcgtccagttcgcaagaatccaccaaacaacaatccggatccgaattaaaaaagagc
gcaacgatccagaaaaacccgcgcaaaagctcagacagcctcaaaaccggcacttccaag
tcatcagaccccaaaccggcccctaaacccaaaacccaagcccccaaaaccgggaaacaa
ccggccaaaaccaccatctactcgtcggaagatgacgacaaacctaaacctagcgcgaag
cgcaaaagcacagcaaagcctaaaagcagcgccacgatcacgcctaaagccgccactaag
ccgctgcctaaaccggccgttaaaaacgtgcaaaataagggcgccaaagggaaggaacca
ccgaagaaggtggtcgggaaaaacgcaaagaatgattccgccaacaagaaaaaaagcatt
ttctcgccggaaaatagctccgaatccgacgatgcggccaagaagagtcggccgaagccc
gcgccacctaaaccccggcccaaggctgcggccagaacggtcgagaagcccaaacctgtg
gagaagaagcccgaaaaaccggcgcctaaatctaaggccgtggtcagttctgcgagttcg
gctacgtcctcaaccgcctctagtagcagctctgatagtgagagtagcgccgaatcgtcc
agcactactcggaaaatgagcgataaaaaaattacgaaaaaaactttggttgctgccaaa
gatcgaaatgtgtctgattcggagacggaaagcacgaaacaagtcactcggaagttgact
cgctccgctagcacccgaaaatccaagcatgttttgggcaaaagcgtctattccgacacg
gattcggacaccgaaagcacgaaaagatcgctgagtcggtcccccgtcaagcgcgcccca
gtcaccacaaaaggcaaaaccaagaacaataaacgcaacgacgccaagtcgcgagccgag
gaaataataataatcgaggagcgcaaatgccccctggaaggctgcaacagtgtgggccac
ctgagcggcaaatacgagaaacacttcactctggaagcctgccccatgtaccacaacctg
acgccggcccagtgcaaggaagagctgctggaacgcaaaaagcgcgaagaaatgcggcgg
aaagccctggagttccaccggaaatcgccgcggccgcagccaacccaagagcagaagcaa
tacttgcagaaaatccgcgacattcacttaaaattcaaatcagagccgatggaagagaca
aaaccgcaaaatctcgacaaaaaccgcgagccggatttatcgaatttcgtgcccgattac
gatctgaagctgttcagggacgcacaggcgttggcgagcgagaagatcgaggaggatttg
aagacgcagccgaacaccaaagggacgaaatgcatcgaaatgggcaagtttgagatggag
gtctggtaccagagtccctatcctgaggattacgcgcgcttgccgaaactttatatctgc
gagtactgcttgcggtacatgaaaacgaggactgttctgcagagacatgtcgttaagtgt
gtctggagacacccgcccggggaggaagtctaccgcaaagataaaataagtgtgtgggaa
gtggacgggaaacggtataaacagtactgccagaatttgtgtctgttggcgaagtttttt
ctggatcataagacgctctattatgacgttgagccgttcttgttctatgtcatgacgatt
gtggacacggagggctgtcacaccgtgggatatttcagcaagcaccggaagcctttcggc
cttcaagaaaagaactccttcctgaattacaacgtatcctgtatcctgactttgccaccc
tatcagcggcaaggatatggaaggcttcttatcgaattcagttacttgctgacgaaagtc
gagggaaagatcggctcccccgagaagcccttgagcgacttgggattgatttcttatcgc
tcgtattggaaagacgtcctgctggcgtacctgtgctctggaccgggcacgcagttatca
gtgaaagatatcagccaagagatggcgatacactcttatgacatcgtctcgacgctgcaa
gcgctcgggatgatgaaatattggaagggaaagcacatcatcctcaagaagcaggacgtt
ctggacgaatacatcgagcgcgtcaagaagcggggctccatggtcaaggaagtggaccgc
tcctgtctcaggtggacgccgccccagcccgcatccctctga

DBGET integrated database retrieval system