KEGG   Tribolium castaneum (red flour beetle): 659014Help
Entry
659014            CDS       T01046                                 

Definition
hypothetical protein
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    659014
Messenger RNA biogenesis [BR:tca03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     659014
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG5
AA seq 1010 aa AA seqDB search
MSHYSRNNNSFVTPPRASFRRYSLADTSSLTPTRATSALYNNHLSTKIGSRSPGYTTRVV
QYSEEHGRSRPSHQHKYNKLGSFPIVHFFKKELPSLKRKGSEGNISQMNSAELSRFNSPE
QNRLLLEKIIKSSPNNDSISHKTETNTKSVLDALKEISRKRIHASEEDFILKDEGKRLHK
EYDNEGASRKRLRQNSLSPSSRYSSISELIASHSSMDGYLEEEKKKENLVKLSVPPVTPL
KTPPIVKTCVDVETQTIIPEPTPDSSKVVIPQKEEKENVSVNEARPQVKVKKASPLKIFD
ETPLETMRKNRLTALMGSVQNKNQKQEEETKSDEKSAKPLVSILSPTNKSPHKSNKHVTF
DIPQSENSPVSSTTPVTFSESTTPTKLVEAVTSTSTAISTPIVSASVVEVPPMTFKAAGD
APPPAVTSTPPASKTISFGNTNTFSVSSTVTPTTFTSLPTVKPTEVKPTVEKTPLPSFSS
PSQNFEPKTSVTTSNFTFGKLSEPVVPTQKGGFKFELKDATTSVGTSSPFQFKSPAVTTS
APAEKPVSTFGTIKPANSLQLAQVTSSNPVTTLPTFGVTTTSSDSPSKNFLMPSATMFSV
NKTSSPTTSTFMRPPNPLQTANSSMFNPPPSSNKPSMFSFGSTSTATSTATFAPSFTPST
TPGLFEPKSALSGSAKPSLNFSAPNSFTMSPVTTSSSFALPPVTTTSAMPFAFKPTTSFS
STVASTTSTFSNPVFGTNTTANFGGGASGAKPVFGQQAATGPLFSTTGSSFGTTNTFGTT
SAFGANNSSQNVFGAVATTTSSIFGGSNTFGTAGSSFGNSFGSGQSSAFNEPKSQPTPSF
GTPGSSAFGVTTTASFGTNSTVFTTTASGFSASNNTFSSTFGSSSAFDKPAEAASPFGGG
GSTFGGATFGANPPVTQSGVFAFGTEGTKPPVFSFGSAEPPKPSFNFTAGSGGFDAGKGF
GGNPPPAFNPGLTPQFNMPAPVGTGMFNIGSGGTSTPNRSRTMHKTKRRT
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgtcacactattcaaggaacaacaattcgtttgtgactccacctcgggcatcctttcga
cggtattcgttagcggacacatcgtctctgacaccaacaagagcgacaagcgcgctgtac
aataatcacttgagcaccaaaattggcagtaggagccctggttatacaactcgagtggtg
caatacagcgaggagcatgggcgatccaggcctagccaccagcacaagtataacaaactg
ggcagcttccctattgttcatttcttcaagaaagaattaccaagtttaaaaagaaaaggt
agtgaaggcaacatttcccaaatgaattcggctgagttgtcaaggtttaatagtcccgaa
cagaacagattattgttggaaaaaattatcaaaagtagtccgaacaatgacagcatttcg
cataaaactgagaccaacaccaagagcgttttagacgccttgaaggaaatttcgcggaaa
cggattcacgccagtgaggaggactttatcttgaaagatgagggtaaaaggttgcacaag
gagtatgataacgagggggcttcaagaaaacgcttaagacaaaattccttgagtccttca
agtcgttattcgtcgattagtgaactaatcgcgtcacattcgtcaatggatggatattta
gaagaagagaagaagaaggagaatttagtaaaattgtcagttccaccagtcacccccttg
aagacccctccaatcgtcaagacgtgtgttgacgttgaaactcaaactattatccctgaa
cccaccccagactccagtaaagtagttataccacaaaaggaagaaaaggaaaatgtgagt
gttaacgaagctcgaccacaagtcaaggtgaaaaaagcgtcccctcttaaaattttcgat
gaaacacctctggaaacaatgcggaagaatcgactcacagctttgatgggttcagttcaa
aataagaatcaaaaacaagaagaagagacgaaaagtgacgagaaatcagcaaaaccactc
gtctccatcctctcaccgactaacaaaagcccccacaagagtaacaaacatgttactttt
gatatcccgcagtcggaaaattctcccgtttcaagtactaccccggtcacgtttagtgaa
agtaccactccaactaaacttgtagaagctgtaactagtacttccacagctataagtact
ccgattgtttcggcaagtgttgtagaggtgcctcctatgacttttaaggcggcaggtgat
gcgcctccacctgccgttacctcaactcccccagctagtaaaaccataagttttggaaac
acaaacacattcagtgtttccagtactgttactccaaccacgtttactagtttaccaacc
gttaaaccaactgaagtgaagcccacagttgagaaaacacctctaccaagcttttccagt
ccgagtcaaaattttgaaccaaaaactagtgtgacaactagtaattttacgtttgggaaa
ctctctgaaccagttgtgccaacacagaaaggcgggttcaagtttgagctaaaggacgct
actactagtgttggtacatcgtcaccgtttcagtttaaaagtcccgcagtgaccacgtcc
gctcccgcggaaaaaccagttagtactttcggtactattaaaccagcaaattcgttacaa
cttgcacaagtcacttcttccaacccagtgactactttgcctacgtttggtgtaacaaca
acttcgagtgattcccccagcaagaatttcctaatgccgtctgctaccatgttttccgta
aacaaaactagttctccaaccacaagtacgttcatgcgcccgccgaatccgctccaaaca
gctaactcgtcaatgtttaatcctccaccatcctccaacaaaccgtcaatgttttcgttc
ggtagtacaagcactgcaacttcaaccgcaacttttgctccaagttttacgccctcgaca
actcccggcctgtttgagcccaaatctgccttaagtggttccgcgaaaccgtcgttgaat
ttttccgcccccaattcattcacaatgtctccagtgaccacttcaagtagctttgccctg
cctcctgtaacgacaacttccgcaatgcccttcgctttcaagccgactactagttttagt
agtactgtggcatcgaccacttcaacattttcgaacccagtttttggtactaacactact
gcgaattttggtggtggtgctagtggagcgaaaccagtttttgggcaacaagcagcgact
ggccctttgttttcaaccactggttccagttttggtaccactaacacttttggcacaact
tcagcttttggagcaaacaactccagccagaacgtcttcggggctgttgccacaacaacg
agtagtatttttggcggttctaatactttcggtacggctggttcttccttcggtaactcg
ttcggaagtgggcaaagctccgcatttaacgaacccaaaagccaaccaacaccttcattt
ggtactcccggaagttcggctttcggtgtcacgactaccgcaagtttcggtacgaattca
acggtttttaccacaacagcgtccggtttttcggcaagtaataatactttttcctcgact
tttggctcaagttcagcgtttgataagccagcagaagcggcaagtccgtttggtggtggt
ggtagtacctttggaggtgctacttttggtgccaatcctccagttacacaaagtggtgtt
tttgcgtttggtactgaaggtacgaaaccgcctgttttttcgttcggttccgcagaaccg
cccaaaccttcgtttaattttacggcaggttcgggtggtttcgatgctgggaaaggtttc
ggtgggaatccacccccagcgtttaatcccggtttgacgccgcagttcaatatgccagct
cctgtgggaacggggatgtttaatataggcagtggggggacgtccacgcccaataggtcc
aggactatgcataagactaagcgaagaacgtga

DBGET integrated database retrieval system