KEGG   Tribolium castaneum (red flour beetle): 659014Help
Entry
659014            CDS       T01046                                 

Definition
hypothetical protein
Organism
tca  Tribolium castaneum (red flour beetle)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG5
AA seq 1010 aa AA seqDB search
MSHYSRNNNSFVTPPRASFRRYSLADTSSLTPTRATSALYNNHLSTKIGSRSPGYTTRVV
QYSEEHGRSRPSHQHKYNKLGSFPIVHFFKKELPSLKRKGSEGNISQMNSAELSRFNSPE
QNRLLLEKIIKSSPNNDSISHKTETNTKSVLDALKEISRKRIHASEEDFILKDEGKRLHK
EYDNEGASRKRLRQNSLSPSSRYSSISELIASHSSMDGYLEEEKKKENLVKLSVPPVTPL
KTPPIVKTCVDVETQTIIPEPTPDSSKVVIPQKEEKENVSVNEARPQVKVKKASPLKIFD
ETPLETMRKNRLTALMGSVQNKNQKQEEETKSDEKSAKPLVSILSPTNKSPHKSNKHVTF
DIPQSENSPVSSTTPVTFSESTTPTKLVEAVTSTSTAISTPIVSASVVEVPPMTFKAAGD
APPPAVTSTPPASKTISFGNTNTFSVSSTVTPTTFTSLPTVKPTEVKPTVEKTPLPSFSS
PSQNFEPKTSVTTSNFTFGKLSEPVVPTQKGGFKFELKDATTSVGTSSPFQFKSPAVTTS
APAEKPVSTFGTIKPANSLQLAQVTSSNPVTTLPTFGVTTTSSDSPSKNFLMPSATMFSV
NKTSSPTTSTFMRPPNPLQTANSSMFNPPPSSNKPSMFSFGSTSTATSTATFAPSFTPST
TPGLFEPKSALSGSAKPSLNFSAPNSFTMSPVTTSSSFALPPVTTTSAMPFAFKPTTSFS
STVASTTSTFSNPVFGTNTTANFGGGASGAKPVFGQQAATGPLFSTTGSSFGTTNTFGTT
SAFGANNSSQNVFGAVATTTSSIFGGSNTFGTAGSSFGNSFGSGQSSAFNEPKSQPTPSF
GTPGSSAFGVTTTASFGTNSTVFTTTASGFSASNNTFSSTFGSSSAFDKPAEAASPFGGG
GSTFGGATFGANPPVTQSGVFAFGTEGTKPPVFSFGSAEPPKPSFNFTAGSGGFDAGKGF
GGNPPPAFNPGLTPQFNMPAPVGTGMFNIGSGGTSTPNRSRTMHKTKRRT
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgtcacactattcaaggaacaacaattcgtttgtgactccacctcgggcatcctttcga
cggtattcgttagcggacacatcgtctctgacaccaacaagagcgacaagcgcgctgtac
aataatcacttgagcaccaaaattggcagtaggagccctggttatacaactcgagtggtg
caatacagcgaggagcatgggcgatccaggcctagccaccagcacaagtataacaaactg
ggcagcttccctattgttcatttcttcaagaaagaattaccaagtttaaaaagaaaaggt
agtgaaggcaacatttcccaaatgaattcggctgagttgtcaaggtttaatagtcccgaa
cagaacagattattgttggaaaaaattatcaaaagtagtccgaacaatgacagcatttcg
cataaaactgagaccaacaccaagagcgttttagacgccttgaaggaaatttcgcggaaa
cggattcacgccagtgaggaggactttatcttgaaagatgagggtaaaaggttgcacaag
gagtatgataacgagggggcttcaagaaaacgcttaagacaaaattccttgagtccttca
agtcgttattcgtcgattagtgaactaatcgcgtcacattcgtcaatggatggatattta
gaagaagagaagaagaaggagaatttagtaaaattgtcagttccaccagtcacccccttg
aagacccctccaatcgtcaagacgtgtgttgacgttgaaactcaaactattatccctgaa
cccaccccagactccagtaaagtagttataccacaaaaggaagaaaaggaaaatgtgagt
gttaacgaagctcgaccacaagtcaaggtgaaaaaagcgtcccctcttaaaattttcgat
gaaacacctctggaaacaatgcggaagaatcgactcacagctttgatgggttcagttcaa
aataagaatcaaaaacaagaagaagagacgaaaagtgacgagaaatcagcaaaaccactc
gtctccatcctctcaccgactaacaaaagcccccacaagagtaacaaacatgttactttt
gatatcccgcagtcggaaaattctcccgtttcaagtactaccccggtcacgtttagtgaa
agtaccactccaactaaacttgtagaagctgtaactagtacttccacagctataagtact
ccgattgtttcggcaagtgttgtagaggtgcctcctatgacttttaaggcggcaggtgat
gcgcctccacctgccgttacctcaactcccccagctagtaaaaccataagttttggaaac
acaaacacattcagtgtttccagtactgttactccaaccacgtttactagtttaccaacc
gttaaaccaactgaagtgaagcccacagttgagaaaacacctctaccaagcttttccagt
ccgagtcaaaattttgaaccaaaaactagtgtgacaactagtaattttacgtttgggaaa
ctctctgaaccagttgtgccaacacagaaaggcgggttcaagtttgagctaaaggacgct
actactagtgttggtacatcgtcaccgtttcagtttaaaagtcccgcagtgaccacgtcc
gctcccgcggaaaaaccagttagtactttcggtactattaaaccagcaaattcgttacaa
cttgcacaagtcacttcttccaacccagtgactactttgcctacgtttggtgtaacaaca
acttcgagtgattcccccagcaagaatttcctaatgccgtctgctaccatgttttccgta
aacaaaactagttctccaaccacaagtacgttcatgcgcccgccgaatccgctccaaaca
gctaactcgtcaatgtttaatcctccaccatcctccaacaaaccgtcaatgttttcgttc
ggtagtacaagcactgcaacttcaaccgcaacttttgctccaagttttacgccctcgaca
actcccggcctgtttgagcccaaatctgccttaagtggttccgcgaaaccgtcgttgaat
ttttccgcccccaattcattcacaatgtctccagtgaccacttcaagtagctttgccctg
cctcctgtaacgacaacttccgcaatgcccttcgctttcaagccgactactagttttagt
agtactgtggcatcgaccacttcaacattttcgaacccagtttttggtactaacactact
gcgaattttggtggtggtgctagtggagcgaaaccagtttttgggcaacaagcagcgact
ggccctttgttttcaaccactggttccagttttggtaccactaacacttttggcacaact
tcagcttttggagcaaacaactccagccagaacgtcttcggggctgttgccacaacaacg
agtagtatttttggcggttctaatactttcggtacggctggttcttccttcggtaactcg
ttcggaagtgggcaaagctccgcatttaacgaacccaaaagccaaccaacaccttcattt
ggtactcccggaagttcggctttcggtgtcacgactaccgcaagtttcggtacgaattca
acggtttttaccacaacagcgtccggtttttcggcaagtaataatactttttcctcgact
tttggctcaagttcagcgtttgataagccagcagaagcggcaagtccgtttggtggtggt
ggtagtacctttggaggtgctacttttggtgccaatcctccagttacacaaagtggtgtt
tttgcgtttggtactgaaggtacgaaaccgcctgttttttcgttcggttccgcagaaccg
cccaaaccttcgtttaattttacggcaggttcgggtggtttcgatgctgggaaaggtttc
ggtgggaatccacccccagcgtttaatcccggtttgacgccgcagttcaatatgccagct
cctgtgggaacggggatgtttaatataggcagtggggggacgtccacgcccaataggtcc
aggactatgcataagactaagcgaagaacgtga

DBGET integrated database retrieval system