KEGG   Tribolium castaneum (red flour beetle): 659014Help
Entry
659014            CDS       T01046                                 

Definition
uncharacterized LOC659014
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    659014
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG5
AA seq 999 aa AA seqDB search
MSHYSRNNNSYSLADTSSLTPTRATSALYNNHLSTKIGSRSPGYTTRVVQYSEEHGRSRP
SHQHKYNKLGSFPIVHFFKKELPSLKRKGSEGNISQMNSAELSRFNSPEQNRLLLEKIIK
SSPNNDSISHKTETNTKSVLDALKEISRKRIHASEEDFILKDEGKRLHKEYDNEGASRKR
LRQNSLSPSSRYSSISELIASHSSMDGYLEEEKKKENLVKLSVPPVTPLKTPPIVKTCVD
VETQTIIPEPTPDSSKVVIPQKEEKENVSVNEARPQVKVKKASPLKIFDETPLETMRKNR
LTALMGSVQNKNQKQEEETKSDEKSAKPLVSILSPTNKSPHKSNKHVTFDIPQSENSPVS
STTPVTFSESTTPTKLVEAVTSTSTAISTPIVSASVVEVPPMTFKAAGDAPPPAVTSTPP
ASKTISFGNTNTFSVSSTVTPTTFTSLPTVKPTEVKPTVEKTPLPSFSSPSQNFEPKTSV
TTSNFTFGKLSEPVVPTQKGGFKFELKDATTSVGTSSPFQFKSPAVTTSAPAEKPVSTFG
TIKPANSLQLAQVTSSNPVTTLPTFGVTTTSSDSPSKNFLMPSATMFSVNKTSSPTTSTF
MRPPNPLQTANSSMFNPPPSSNKPSMFSFGSTSTATSTATFAPSFTPSTTPGLFEPKSAL
SGSAKPSLNFSAPNSFTMSPVTTSSSFALPPVTTTSAMPFAFKPTTSFSSTVASTTSTFS
NPVFGTNTTANFGGGASGAKPVFGQQAATGPLFSTTGSSFGTTNTFGTTSAFGANNSSQN
VFGAVATTTSSIFGGSNTFGTAGSSFGNSFGSGQSSAFNEPKSQPTPSFGTPGSSAFGVT
TTASFGTNSTVFTTTASGFSASNNTFSSTFGSSSAFDKPAEAASPFGGGGSTFGGATFGA
NPPVTQSGVFAFGTEGTKPPVFSFGSAEPPKPSFNFTAGSGGFDAGKGFGGNPPPAFNPG
LTPQFNMPAPVGTGMFNIGSGGTSTPNRSRTMHKTKRRT
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atgtcacactattcaaggaacaacaattcgtattcgttagcggacacatcgtctctgaca
ccaacaagagcgacaagcgcgctgtacaataatcacttgagcaccaaaattggcagtagg
agccctggttatacaactcgagtggtgcaatacagcgaggagcatgggcgatccaggcct
agccaccagcacaagtataacaaactgggcagcttccctattgttcatttcttcaagaaa
gaattaccaagtttaaaaagaaaaggtagtgaaggcaacatttcccaaatgaattcggct
gagttgtcaaggtttaatagtcccgaacagaacagattattgttggaaaaaattatcaaa
agtagtccgaacaatgacagcatttcgcataaaactgagaccaacaccaagagcgtttta
gacgccttgaaggaaatttcgcggaaacggattcacgccagtgaggaggactttatcttg
aaagatgagggtaaaaggttgcacaaggagtatgataacgagggggcttcaagaaaacgc
ttaagacaaaattccttgagtccttcaagtcgttattcgtcgattagtgaactaatcgcg
tcacattcgtcaatggatggatatttagaagaagagaagaagaaggagaatttagtaaaa
ttgtcagttccaccagtcacccccttgaagacccctccaatcgtcaagacgtgtgttgac
gttgaaactcaaactattatccctgaacccaccccagactccagtaaagtagttatacca
caaaaggaagaaaaggaaaatgtgagtgttaacgaagctcgaccacaagtcaaggtgaaa
aaagcgtcccctcttaaaattttcgatgaaacacctctggaaacaatgcggaagaatcga
ctcacagctttgatgggttcagttcaaaataagaatcaaaaacaagaagaagagacgaaa
agtgacgagaaatcagcaaaaccactcgtctccatcctctcaccgactaacaaaagcccc
cacaagagtaacaaacatgttacttttgatatcccgcagtcggaaaattctcccgtttca
agtactaccccggtcacgtttagtgaaagtaccactccaactaaacttgtagaagctgta
actagtacttccacagctataagtactccgattgtttcggcaagtgttgtagaggtgcct
cctatgacttttaaggcggcaggtgatgcgcctccacctgccgttacctcaactccccca
gctagtaaaaccataagttttggaaacacaaacacattcagtgtttccagtactgttact
ccaaccacgtttactagtttaccaaccgttaaaccaactgaagtgaagcccacagttgag
aaaacacctctaccaagcttttccagtccgagtcaaaattttgaaccaaaaactagtgtg
acaactagtaattttacgtttgggaaactctctgaaccagttgtgccaacacagaaaggc
gggttcaagtttgagctaaaggacgctactactagtgttggtacatcgtcaccgtttcag
tttaaaagtcccgcagtgaccacgtccgctcccgcggaaaaaccagttagtactttcggt
actattaaaccagcaaattcgttacaacttgcacaagtcacttcttccaacccagtgact
actttgcctacgtttggtgtaacaacaacttcgagtgattcccccagcaagaatttccta
atgccgtctgctaccatgttttccgtaaacaaaactagttctccaaccacaagtacgttc
atgcgcccgccgaatccgctccaaacagctaactcgtcaatgtttaatcctccaccatcc
tccaacaaaccgtcaatgttttcgttcggtagtacaagcactgcaacttcaaccgcaact
tttgctccaagttttacgccctcgacaactcccggcctgtttgagcccaaatctgcctta
agtggttccgcgaaaccgtcgttgaatttttccgcccccaattcattcacaatgtctcca
gtgaccacttcaagtagctttgccctgcctcctgtaacgacaacttccgcaatgcccttc
gctttcaagccgactactagttttagtagtactgtggcatcgaccacttcaacattttcg
aacccagtttttggtactaacactactgcgaattttggtggtggtgctagtggagcgaaa
ccagtttttgggcaacaagcagcgactggccctttgttttcaaccactggttccagtttt
ggtaccactaacacttttggcacaacttcagcttttggagcaaacaactccagccagaac
gtcttcggggctgttgccacaacaacgagtagtatttttggcggttctaatactttcggt
acggctggttcttccttcggtaactcgttcggaagtgggcaaagctccgcatttaacgaa
cccaaaagccaaccaacaccttcatttggtactcccggaagttcggctttcggtgtcacg
actaccgcaagtttcggtacgaattcaacggtttttaccacaacagcgtccggtttttcg
gcaagtaataatactttttcctcgacttttggctcaagttcagcgtttgataagccagca
gaagcggcaagtccgtttggtggtggtggtagtacctttggaggtgctacttttggtgcc
aatcctccagttacacaaagtggtgtttttgcgtttggtactgaaggtacgaaaccgcct
gttttttcgttcggttccgcagaaccgcccaaaccttcgtttaattttacggcaggttcg
ggtggtttcgatgctgggaaaggtttcggtgggaatccacccccagcgtttaatcccggt
ttgacgccgcagttcaatatgccagctcctgtgggaacggggatgtttaatataggcagt
ggggggacgtccacgcccaataggtccaggactatgcataagactaagcgaagaacgtga

DBGET integrated database retrieval system