KEGG   Tribolium castaneum (red flour beetle): 659062Help
Entry
659062            CDS       T01046                                 

Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    659062
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    659062
   04070 Phosphatidylinositol signaling system
    659062
 Organismal Systems
  Sensory system
   04745 Phototransduction - fly
    659062
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     659062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG4
AA seq 1080 aa AA seqDB search
MTKKFEFDWHVPVPEPLLTGCVVDRWSEEPNEIEWKALFRVDEYGFFIYWKSEGKEGDVI
ELCQVSDVRAGGLPKDLKLFSQLESRHGPDLEKRSLTICSGTDYININYQHIVCPNAETA
KVWLDGLRKITHNVKANNFCPMTCLKKHWMRLGFLTDAKGKVPVKVVARTFASGKSTEKL
VYQCLADLDLPNGKNAVMEPEQFTFEKFYTLYHKICPRNDIEELFRSITQGKADYMNLEQ
FINFLNEKQRDPRLNEILYPHYDAKRASEIIATYEQDEEAKAANRLTKDGLIRYLMSDEN
APVFLDRLDIYMDMDQPLCAYYINSSHNTYLSGRQFGGRSSVEMYRQVLLAGCRCVELDC
WDGRGEDEEPIITHGRAMCTDILFKDVIYAIRDTAFVTSDYPVILSFENHCCKSQQYKLA
KYCDEILGDLLLKEPLPDYPLEPGLPLPPPSCLKRKILIKNKRLKPEVEKQELELFRQGE
FVIEDEEKEDASASADRPIPPDISAETPAPDGGAGDGDIAAPPIIHTGSTTNVHPWLSSM
VNYAQPVKFTSFDYAEEKNIHYNMSSFSEPVGLNLLKTQAIEFVNYNKRQMSRIYPSGAR
ANSSNYMPQVFWNAGCQMVSLNFQTSDLPMQLNQGKFEYNGNCGYLLKPDFMRRPDRTFD
PFAESPVDGVIAAQCSVQVIAGQFLSDKKVGTYVEVDMYGLPTDTIRREFRTRMVPANGL
NPVYNEEPFLFRKVVLPDLAVLRFGVYDENNRLLGQRILPLDGLQAGYRHISLRTEANFP
MSLPMLFCNIELKIYVPDGFEDFMAALSDPRGFSGARQKQNEQMSSMGIEVTDKGTEKKE
KEKEEKKEEPLVFEPITIESIKQDKAFQKTTKKQQKEYDTLKKKQTKEKLAVQKSQCSAI
DKLIKGKNKTDLVNDPGVRKLVTEQTLEWSALMERHRKQEWEFLRNQLDEQRDALKRHMV
ILQAAQMKQLEAKHDREFKEMIGQQAKVSVEIAKEVANDKNLKTKRDKERRLKEKQQNNT
KRFLEERKTASNRQAKEKEKLKIKHEKQLEMLSHDIQKLIDMYKNEELEYEMSSKSEFFA
NT seq 3243 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaaaattcgagttcgattggcatgtccccgtgccggagcccctgctcacgggc
tgcgtcgtggacaggtggtcggaggagcccaacgaaatcgaatggaaagcccttttccgg
gtggacgagtacggatttttcatctattggaagagcgagggaaaggagggcgacgtcatc
gaactgtgccaagtgagcgatgtgagggccggtgggctgcccaaagacctcaaactgttc
agccagctcgaaagccgacacgggcccgatcttgagaagagatcgctgaccatctgtagc
gggaccgactatatcaacattaattaccagcacatcgtgtgccccaatgccgagacggca
aaggtttggttggacggtttgcgaaagataacacataacgtgaaagccaataacttctgt
ccgatgacgtgtttgaaaaaacattggatgcgactcggttttctgaccgatgccaagggt
aaagtgcccgtcaaagtcgtagcgcgtactttcgcctccggcaaaagtacagaaaagttg
gtttatcagtgtttggccgacttggatctaccgaacggcaaaaacgcagtcatggagccc
gagcaattcaccttcgagaaattctacactttgtatcacaaaatctgccctcggaacgac
atcgaggagctcttccgcagcattacgcaaggcaaagccgactatatgaatctcgagcag
tttattaatttcctcaacgagaaacagcgagacccgcgtttgaacgaaattttgtaccca
cattatgacgcgaaacgagcgtccgaaataattgccacttatgaacaagacgaggaggcg
aaggcagcaaataggttgacaaaagacggtctgattaggtatttaatgtcggacgaaaac
gctccggtgtttttggaccgtttggacatctacatggatatggaccagcctctatgcgcc
tactatataaattctagtcacaatacgtatttaagtggccgccagtttggcggtaggtct
tccgttgaaatgtacagacaagtattgctggcggggtgtcgctgcgtcgaactcgactgt
tgggacggccgaggcgaagacgaggagccgatcataacccacggacgcgccatgtgcacg
gacatcctcttcaaagacgtaatctacgcaatccgagacaccgctttcgtaacatccgac
tatcccgtaatcctctcctttgagaaccactgctgcaaaagccaacagtacaagctcgcg
aaatattgcgacgaaatcttgggcgatttgctcctcaaagaaccacttcctgactatccc
cttgaaccaggcctcccgttaccgccaccttcatgcctcaagcgtaaaattttaatcaag
aataagagactcaaaccagaggtggagaaacaagaactggagttgttcagacagggggag
ttcgttatcgaagatgaggaaaaagaggatgcgagtgcgtccgcagaccggcctatacca
ccggatatttcggctgaaacaccggcgcccgatgggggggctggtgacggggacatcgca
gcgccgcctataatacacacggggtcgactactaatgtgcatccgtggttgagttcgatg
gttaattatgcccaacctgtcaaattcactagttttgattatgcggaagagaaaaacata
cattacaacatgtcaagtttttcggaacctgtcggcttgaatttgctcaagactcaggcg
attgagttcgtcaattacaacaaacgccaaatgtcgcgcatttacccgagcggcgctcgg
gccaactcgtcgaactatatgccgcaggttttctggaatgctggttgtcaaatggtctct
ttaaatttccaaacttccgatcttcccatgcaactcaatcaaggcaaatttgagtacaac
ggcaactgtggttatttattaaaaccggattttatgcgacgtcccgaccggactttcgat
ccgttcgctgaaagtccagtagatggcgttattgcggcccaatgttcggtccaggtgatc
gctgggcagttcttgtccgacaaaaaggttggtacctacgtcgaggtcgatatgtacggc
ttgccgaccgatacgatccgacgcgagttccgaactcggatggttccggccaatggtttg
aatccggtgtataacgaagaaccgtttcttttccggaaagtggttcttccggacttggct
gtgctacgatttggggtttacgacgagaataacagacttttgggtcagagaattttgcca
ttggatggtctccaagccggctatcggcacatttccttaagaactgaagccaatttcccc
atgtcgcttccaatgttgttttgtaacattgagttaaagatctacgtcccggatggtttt
gaggacttcatggccgcactgagtgaccctcgggggttcagcggagcccgacaaaagcaa
aacgaacaaatgtcatcgatgggaatcgaagtgaccgataaaggaacggaaaagaaggaa
aaagagaaagaagagaagaaggaagaaccgcttgttttcgaaccaatcaccatagaatca
ataaaacaagacaaagccttccagaaaaccaccaaaaaacagcaaaaagaatatgacacg
cttaaaaagaagcaaacgaaggagaagctcgccgtgcaaaagtcgcaatgttcggccatc
gataagttaatcaagggcaaaaacaaaactgatctggttaatgacccaggggtgcgcaag
ctcgtaaccgagcaaactctcgagtggtcggccctgatggagcgccaccgtaaacaagag
tgggaatttttgcgtaatcagttggacgaacaacgtgacgcgttaaagcgtcacatggtg
attttacaagctgctcaaatgaaacaattagaggccaaacatgacagggaatttaaagag
atgatcggtcaacaagcgaaagtttcggtcgaaattgccaaagaagttgccaatgataaa
aacttgaaaactaagcgagacaaggagcggagactgaaggagaagcagcaaaacaatacg
aaacggtttctggaagagagaaaaactgcatcgaatcgacaagccaaagagaaggagaag
ttgaagatcaagcacgagaagcagctggaaatgctgtcgcatgacatccagaagctgatc
gacatgtacaagaatgaggagttggagtatgagatgtcgagcaaaagcgagttttttgct
taa

DBGET integrated database retrieval system