KEGG   Tribolium castaneum (red flour beetle): 659187Help
Entry
659187            CDS       T01046                                 

Gene name
Hexo1, Nag1
Definition
hexosaminidase 1
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tca00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:tca00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:tca00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:tca00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tca00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:tca04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG7
AA seq 598 aa AA seqDB search
MKHSLATYLLFLALLKNISALNGAWRWECKSNYCQKAPITPDTEATGLSLPACRLFCSEA
AALWPKPTGEVHVGTTLVKVNINSINTGGLTFETAAHKIMAGATKRFRNQIEALVPRKLR
LADGGKTLEINYKLIDPDLKELNLDTKESYALTVAETADGRLNATIIADNVFGGRHGLET
LNQLIIYDDLRDQLLMPNDVSITDEPAYQYRGIALDTSRNFVTVDVIKRTLDGMAASKLN
SFHWHITDSHSFPFTAESLPDLTKYGAYSPKKVYAPEEVAEIVEYGLERGVRVIPEFDAP
AHVGEGWQNTDFVVCFNAKPWSNYCVEPPCGQLDPTKEKLYDAIEALYGDMLKQFKPPLF
HMGGDEVHLGCWNSTPSIVQWMQDQKGWGRSEGDFIKLWDMFQNESLTRLYKKAGKEIPV
ILWTSTLTQKEYLENLPSDKYIIQIWTTGSDPQVRNLLDNGYRVILSNYDALYFDCGFAG
WVTDGNNWCSPYIGWQKVYENKPAKIAGDKKGQVLGAEAALWTEQADSASVDTRLWPRAA
ALGEVLWSEPTNTWREAEQRILVQRERLISLGINSDALEPEWCWQNEENCPIGGKFAE
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgaagcactcattagccacatatttacttttcctcgcgctactcaaaaatatcagcgcc
ttaaatggagcatggcgctgggaatgcaagagcaactactgccagaaggcccccatcacc
cccgacactgaagccacaggtttgagtctccccgcatgtcgtctgttttgctccgaagcc
gcagccctttggcccaagcccaccggtgaagtccacgtagggaccaccctggtcaaagtc
aatatcaacagtataaacacaggggggcttacttttgaaacagcagcccataaaatcatg
gcgggggcgacaaaacggttcagaaaccaaatcgaagctctggtgccccgaaaactgaga
cttgcagatgggggaaaaacgctggaaattaattacaagcttatcgaccccgatcttaag
gaactcaacctggatacgaaagaatcgtacgctttgacggtcgccgagacggccgatggg
cgtctgaacgccacaatcatcgctgataatgtcttcggggggcggcacgggctggagact
ctgaaccaattgatcatttacgatgatctcagagaccagcttttgatgcccaacgatgtg
agtattaccgacgagccggcgtatcagtacagagggatagctttggatacttcccggaat
ttcgtcactgttgatgttataaagagaacacttgacgggatggccgcttcgaaactgaac
agtttccactggcatatcacggatagtcatagctttccctttacggctgaaagtttgcca
gatttgaccaaatacggggcgtattcgcccaagaaggtttacgctccggaagaagtggct
gaaattgtggaatatggtctggagaggggtgttagggttattccggaatttgacgcccca
gctcacgtcggtgaagggtggcagaacacggatttcgtggtctgttttaacgccaagccc
tggtcgaactactgcgtggagccgccgtgtggccagctggaccccaccaaagagaagctg
tacgacgctattgaagctttatacggcgacatgttaaagcaattcaaaccccctctcttc
catatgggtggcgacgaggtccatttgggctgctggaactccactcccagcatcgtgcaa
tggatgcaagaccaaaagggttggggccgctctgagggagatttcatcaagctttgggac
atgttccagaacgaatccttgactcgtttatacaaaaaagcagggaaagaaattcctgtc
attttgtggacgagtactttgactcagaaagaatatctcgagaatttacctagcgataaa
tatattattcaaatatggacgaccgggagcgacccacaagtcagaaatttgctcgataat
ggctacagagttattttgagtaattatgacgctctctattttgactgcggtttcgccggc
tgggtcaccgatggtaataactggtgctcgccatatatcggatggcagaaagtctacgag
aataaaccagccaaaatcgccggcgataaaaaggggcaagttttgggggccgaagccgct
ctttggaccgaacaggccgatagtgcgagtgttgatactcggctgtggccgcgagcggcg
gctttaggtgaagtactctggagtgaacccacgaatacatggagagaagccgagcaaaga
attttggtgcaaagggaaagactgattagtttgggcataaattcggacgctcttgaaccc
gaatggtgttggcaaaatgaagaaaattgtcccattggtggtaagtttgctgagtga

DBGET integrated database retrieval system