KEGG   Tribolium castaneum (red flour beetle): 659243Help
Entry
659243            CDS       T01046                                 

Gene name
chic
Definition
(RefSeq) chickadee
  KO
K05759  
profilin
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:tca00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    659243 (chic)
Membrane trafficking [BR:tca04131]
 Others
  Actin-binding proteins
   Others
    659243 (chic)
Cytoskeleton proteins [BR:tca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     659243 (chic)
Exosome [BR:tca04147]
 Exosomal proteins
  Proteins found in most exosomes
   659243 (chic)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEETLEBASE: 
UniProt: 
Position
LG5
AA seq 126 aa AA seqDB search
MSWQDYVDKQLLASRCVTKAAIAGHDGNIWAKSEGFDVSKEELAKLVQGFEKQDILTSSG
VTLAGNRYIYLSGTDRVIRAKLGKVGVHCMKTTQAVVVSLYEDPIQPQQAASVVEKLGDY
LITCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaggattacgtagataagcaactcctggcttcaagatgtgtaacaaaagcc
gccatcgcaggacatgatggcaatatctgggccaaatcggaaggattcgacgtttcaaaa
gaagaattagccaaattggtacaaggtttcgaaaaacaagatattcttacgtcgtccggt
gtcaccttagccggcaaccgatacatatatctttccgggacggaccgcgtcattagggcc
aaattgggaaaggttggagtccattgcatgaagacgacacaagccgttgtagtatccctt
tatgaagatcccattcagcctcaacaagcggcgtcggttgtagaaaagctaggtgattac
ttaattacctgcggatactag

DBGET integrated database retrieval system